KEGG   Oryctolagus cuniculus (rabbit): 100338738
Entry
100338738         CDS       T03373                                 
Symbol
CUL3
Name
(RefSeq) cullin 3
  KO
K03869  cullin 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100338738 (CUL3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100338738 (CUL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100338738 (CUL3)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100338738 (CUL3)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     100338738 (CUL3)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100338738 (CUL3)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N DUF6655
Other DBs
NCBI-GeneID: 100338738
NCBI-ProteinID: XP_008257463
Ensembl: ENSOCUG00000010660
LinkDB
Position
7:complement(165998793..166100012)
AA seq 696 aa
MLTLITWCPPDFSTVKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQ
QNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMI
LGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCL
DKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKLFSRVPNGLKT
MCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLQESFNNDRLFKQTIAG
DFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYY
KQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQ
ATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQH
HMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYT
FEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRV
KIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKA
RFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgttaactttgatcacttggtgtccgccagatttctccactgtgaaggtgcgagaagat
gtactaaattcattgaataacaactttcttcaaacactaaaccaagcttggaatgatcat
caaacagctatggtgatgattagagacatactaatgtatatggaccgtgtatatgtacaa
caaaataatgtggagaatgtctacaatttgggattgattatttttcgagatcaagttgtg
cgttatggttgtattagggatcatcttcgacaaactctattggatatgattgcaagagag
cgcaaaggagaagttgtagacagaggcgcaataagaaatgcttgccagatgttaatgatt
ttaggtcttgaaggaagatcagtctatgaagaagattttgaggctccttttttggaaatg
tctgcagaattttttcagatggaaagccagaaatttttagcagagaacagtgcttccgta
tatataaagaaagtagaagctagaattaatgaagaaatagaacgggtgatgcactgcctt
gacaaatcaactgaagaaccaattgtaaaagtggttgagagggaactcatttccaagcac
atgaagactatagtagaaatggagaattctggtctagtccatatgttgaaaaatggaaag
acagaagaccttgcttgcatgtacaagttatttagtcgtgtgccaaatggtttgaaaaca
atgtgtgagtgtatgagttcctatctgagggagcaaggtaaagcccttgtttctgaggaa
ggagaaggaaaaaatcctgttgactatatccagggcctattggatctgaagagtaggttt
gatcgcttcctccaggaatcattcaataatgaccggctctttaaacaaactattgcgggt
gactttgagtattttctcaacctcaactccaggtctcccgaatacctctcattatttatt
gatgataagctgaaaaagggagtcaaagggctaacagaacaagaagtagaaacaatattg
gataaagcaatggtccttttcaggtttatgcaagaaaaagatgtatttgaacgttattat
aaacaacacttggcaaggagactgctcacaaataaaagtgtgtctgatgactctgaaaaa
aacatgatatccaagctaaagactgaatgtggatgtcagttcacatcaaaactggaagga
atgtttagagatatgagcatctcaaacacaactatggatgaattcaggcaacatctacag
gcaacaggggtatccttaggtggtgttgatctcacagtccgggtgctcacaacaggctat
tggcccactcagtcggctacaccaaagtgcaacatcccaccagcaccaagacatgctttt
gagatattcagaaggttctacttagccaaacacagtggtcgacagctcacactccagcat
catatgggttctgcagatctcaatgccactttttatggaccagttaaaaaggaagatgga
tctgaagttggtgttggaggtgcacaagtaactggctctaatacacggaagcacatttta
caagtctctactttccagatgaccatattaatgctttttaataatagagaaaaatacaca
tttgaggaaattcagcaagagacagatatccctgaaagagagcttgttagagccctacag
tccctcgcctgtggtaaaccaacacagcgggttcttaccaaagagcccaagtcaaaggaa
atagaaaatggtcacatatttacagttaacgatcagttcacatccaaactacacagagtc
aagattcaaacagttgctgccaaacaaggtgaatccgacccagaaaggaaagaaacaagg
cagaaagtagacgatgacagaaaacatgagatagaagctgctatagtgcggataatgaaa
tctagaaagaagatgcagcacaatgttttagtagcagaggtaactcagcagttgaaggct
cgattcttaccaagcccagttgttattaagaaacgtattgaaggactaattgagagagaa
tatttggcacgaacacctgaggatcgcaaagtatacacatatgtagcataa

DBGET integrated database retrieval system