KEGG   Oryctolagus cuniculus (rabbit): 100338775
Entry
100338775         CDS       T03373                                 
Symbol
EFNB1
Name
(RefSeq) ephrin B1
  KO
K05463  ephrin-B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100338775 (EFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100338775 (EFNB1)
   04052 Cytokines and growth factors [BR:ocu04052]
    100338775 (EFNB1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100338775 (EFNB1)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100338775 (EFNB1)
SSDB
Motif
Pfam: Ephrin DUF4381 BAMBI_C DUF1180 Baculo_11_kDa Syndecan
Other DBs
NCBI-GeneID: 100338775
NCBI-ProteinID: XP_002720107
Ensembl: ENSOCUG00000013726
UniProt: A0A5F9C517
LinkDB
Position
X:47426032..47439463
AA seq 348 aa
MARPGQRWLGKWLVAMVVLALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL
DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPN
YMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSR
PSKEADNTVKTATHAPGRGRLGDSDGKHETVNQEEKSGPGASGGGGGGGSDPDSFFNSKV
ALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTE
PSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggcccggcctgggcagcgttggctcggcaagtggcttgtggcgatggtcgtattggcg
ctgtgccggctcgccacgccgctggccaagaacctggagcccgtgtcctggagctccctc
aaccctaagttcctgagcgggaagggcttggtgatctacccgaagattggcgacaagctg
gacatcatctgtccccgagcagaagcagggcggccctatgagtactataagctatacctg
gtacggcctgagcaggcagccgcctgtagcaccgtgctggaccccaacgttctggtcacg
tgcaaccggccagagcaggaaatccgcttcaccatcaagttccaggagttcagccccaac
tacatgggcctggagttcaagaagcaccacgattactacattacctcaacatccaatggc
agcctcgaggggctggagaaccgcgagggaggtgtgtgccgtacccgcaccatgaagatc
gtcatgaaggttgggcaagatcccaatgctgtgacacctgagcagctgaccaccagccgg
cccagcaaggaggcagacaacactgtcaagacagccacccatgctcctggtcggggccgc
ctgggtgactctgacggcaaacacgagactgtgaaccaggaagagaagagcggcccggga
gcaagtgggggcggcggcggcggcggcagcgaccccgacagcttcttcaactccaaggtg
gcactgttcgcagccgtcggagcgggctgcgtcatcttcctgctcatcatcatcttcctg
acggttctgctactgaagctacgcaagcggcaccgcaagcacacgcagcagcgggcggct
gcgctctcgctcagcaccctggccagccccaaggggggcagcggcacggcgggcacggaa
cccagcgacatcatcatccccttacggactacagagaacaactactgtccccactatgag
aaggtgagtggggactacgggcaccccgtctacatcgtccaggagatgcctccgcagagt
ccggcgaacatctactacaaggtctga

KEGG   Oryctolagus cuniculus (rabbit): 100352864
Entry
100352864         CDS       T03373                                 
Symbol
EFNB3
Name
(RefSeq) ephrin B3
  KO
K05463  ephrin-B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100352864 (EFNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100352864 (EFNB3)
   04052 Cytokines and growth factors [BR:ocu04052]
    100352864 (EFNB3)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100352864 (EFNB3)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100352864 (EFNB3)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 100352864
NCBI-ProteinID: XP_002718833
Ensembl: ENSOCUG00000002822
UniProt: G1SIE1
LinkDB
Position
19:complement(11492797..11497445)
AA seq 341 aa
MGAPHSGPGGVRFGALLLLGCLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDL
LCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEY
SPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAAPRKP
VSEMPMERDRGAAHSLEPGKENAVPGDPTSNATSRGAEGPLPPPSMPAVAGAAGGLALLL
LGVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGLGPREAEPGELGIALRG
GGAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgggggccccccattctgggccggggggcgtgagattcggggccctgctgctgctgggg
tgtttggggctggtgtctgggctcagcctggagcctgtctactggaactcggcgaataag
aggttccaggcggagggtggctacgtgctctacccccagatcggggaccgactagacctg
ctctgcccccgggcccggcctcctggccctcactcctctcctaattatgagttctacaag
ctgtacctggtcgggggtgcccagggccggcgctgcgaggcaccccctgccccaaacctc
cttctcacttgcgatcgacctgacctggatctccgtttcaccatcaagttccaggagtac
agccctaacctctggggccacgagttccgctcccaccacgattactacataattgccacg
tcggatgggacccgagaaggcctggagagcttgcaggggggcgtgtgcctaaccagaggc
atgaaggtgcttctccgagtgggacaaagtccccgaggaggagctgcaccccgaaagcct
gtgtctgaaatgcccatggagagagaccgaggggcagcccacagcctggagcccgggaag
gagaacgcagtgccaggtgaccccaccagcaatgcaacctcccggggtgctgaaggcccc
ctgccccctcccagcatgcccgctgtggccggggcagcaggggggctggcgctgctcttg
ctgggcgtggcaggggctgggggtgccatgtgctggcggagacggcgggccaagccttcg
gagagtcgccaccctgggcccggctccttcgggaggggagggtctctgggcttggggggc
ggaggcgggctgggaccccgggaggctgagcctggggagctagggatagctctgcggggt
ggtggggctgcagatccccccttctgtccccactatgagaaggtgagtggcgactatggg
catcctgtgtatatcgtgcaggatgggcccccgcagagccccccgaacatctactacaag
gtatga

KEGG   Oryctolagus cuniculus (rabbit): 100357479
Entry
100357479         CDS       T03373                                 
Symbol
EFNB2
Name
(RefSeq) ephrin B2
  KO
K05463  ephrin-B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100357479 (EFNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100357479 (EFNB2)
   04052 Cytokines and growth factors [BR:ocu04052]
    100357479 (EFNB2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100357479 (EFNB2)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100357479 (EFNB2)
SSDB
Motif
Pfam: Ephrin TMEM132D_C RIFIN ECSCR DUF202 DUF4381 LAX
Other DBs
NCBI-GeneID: 100357479
NCBI-ProteinID: XP_008258392
Ensembl: ENSOCUG00000022857
LinkDB
Position
8:complement(108319374..108341061)
AA seq 333 aa
MAVRRDSVWKYCWGVLMVLCRTAISRSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDI
ICPKVDSKAVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDVKFTIKFQEFSPN
LWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNNDPT
RRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIV
IIITLVVLLLRYRRRHRKHSPQHTTTLSLSTLATPKRGANNNGSEPSDIIIPLRTADSVF
CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggccgtccggagggactccgtgtggaagtactgctggggagttttgatggttttgtgc
agaactgcgatctccagatcgatagttttagagcctatctattggaattcctcgaactcc
aaatttctacctggacaaggactggtactatatccacagataggagacaaattggatatt
atatgccccaaagtggactctaaagctgttggccagtatgaatattataaagtttatatg
gttgataaagaccaagcagacagatgcactattaagaaggaaaacacccctctcctcaac
tgtgccaaaccagatcaagatgtaaagttcaccatcaagttccaggagttcagccctaac
ctctggggtctggaatttcagaagaacaaggattactacattatatctacatcaaatggg
tctttggagggcctggataaccaggagggaggggtgtgccagacaagagccatgaagatc
ctcatgaaagttggacaagatgcgagttctgctggatcaacccggaataatgatccaacg
agacgaccagaactagaagctggtacaaatggaagaagttcaacaacaagtccctttgta
aaaccaaatccagggtctagcacagacggcaacagcgccggacattcggggaacaacatc
ctgggttccgaagtggccttattcgcggggatcgcgtcaggatgcatcatcttcatcgtc
atcatcatcaccctggtggtgctgctgctcaggtaccggcggagacaccgcaagcactcg
ccgcagcacacgaccacgctgtcgctcagcacgctggccacgcccaagcgcggcgccaac
aacaacggctcggagcccagcgacatcatcatcccgctgaggactgcggacagcgtcttc
tgcccgcactacgagaaggtcagcggggactacgggcacccggtgtacatcgtgcaggag
atgccgccgcagagcccggccaacatctactacaaggtctga

DBGET integrated database retrieval system