KEGG   Oryctolagus cuniculus (rabbit): 100338780
Entry
100338780         CDS       T03373                                 
Symbol
FES
Name
(RefSeq) FES proto-oncogene, tyrosine kinase
  KO
K07527  tyrosine-protein kinase Fes/Fps [EC:2.7.10.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100338780 (FES)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100338780 (FES)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100338780 (FES)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100338780 (FES)
Protein kinases [BR:ocu01001]
 Non-receptor tyrosine kinases
  FES family
   100338780 (FES)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    100338780 (FES)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 FCH ABC1 Muted DUF6604 DUF6565
Other DBs
NCBI-GeneID: 100338780
NCBI-ProteinID: XP_002721528
Ensembl: ENSOCUG00000002188
LinkDB
Position
Un
AA seq 820 aa
MGFSSELCSPQGHGAVQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSTQDGGGQS
RGPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQ
LQQELTKTHSQDIEKLKSQYRALARDSAQARRKYQEASKDKDRDKAKDKYVRSLWKLFAQ
HNRYVLGVRAAQLHHQHHYQLLLPGLLQSLQDLHEEMARVLKEILQEYLEISSLVQEEVV
AIHREMAAAAARIQPEAEYQGFLRQYGSVPDIPPCVTFDESLLEEGEQLEPGELQLNELT
VESVQHTLTSVTDELATASQVVLSRQEVVTQLQRELQEEEQNTHPRARVQLLGKKQALQE
ALQGLQGALCTQAKLQAQQELLQAKLEQLGPGEPPPVLLLQDDRHSTSSSEQEREGGRTP
TLEILRTHISGIFRPKFSLPPPLQLVPEVQKPLHEQLWYHGAIPRAEVAELLTHCGDFLV
RESQGKQEAVLSVLWDGLPRHFIIQSSDNLYRLEGDGFPSIPLLIDHLLRSQQPLTKKSG
VVLRRAVPKDKWVLKHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDLKA
KFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGGRLRVKTLLQ
MVGDAAAGMEYLESKCCIHRDLAARNCLVTEKHVLKISDFGMSREEADGIYAASGGLRQV
PVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLPCP
ELCPDAVFRLMEQCWAHEPGQRPNFSTIYQELQSIRRRHR
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgggcttctcttcggagctgtgcagcccccagggccacggggctgtccagcagatgcag
gaggccgagctgcgcctgctggaaggcatgaggaagtggatggcccagcgggtgaagagt
gacagggagtacgctggcctgctgcaccacatgtccacacaggacggcgggggccagagc
cggggccccgacagccccatcagccagtcctgggcggagatcaccagccagaccgagggt
ctcagccgcttgctgcggcagcatgcggaggatctgaactcggggcccctgagcaagctg
agcctgctgatccgggagcgccagcagctgcgcaagacctacagcgagcagtggcagcag
ctgcagcaggagctcaccaagacccacagccaggacattgagaaactgaagagccagtac
cgagccctggcacgggacagtgcccaagccaggcgcaagtaccaggaagccagcaaagac
aaagaccgcgacaaggccaaagacaagtacgtgcgcagcctgtggaagctctttgcccag
cacaaccgctacgtgctgggcgtgcgggccgcccagctgcaccatcaacaccactaccag
ctcctgctgcccggcctgttgcagtcactgcaggacctgcacgaggagatggcgcgcgtc
ctgaaggaaatcctgcaggagtacctggagatcagtagcctggtgcaggaggaagtggtg
gccattcaccgggagatggctgcagcggccgcccgcatccagcccgaggccgagtaccaa
ggcttcctgcgacagtatgggtccgtccccgacatccccccctgcgtcacctttgacgag
tcgctccttgaggagggcgagcagctggagcccggggagctgcagctgaacgagctgacc
gtggagagcgtgcaacacacattgacctcggtgacagatgagctggctacggccagccag
gtggtgctgagccggcaggaggtggtcactcagttacagcgtgagctccaggaggaggaa
cagaacacacacccccgggcccgggtacaactgttgggcaagaagcaggcgctgcaggag
gcgctgcaggggctacagggagcactgtgcacccaggccaagctgcaggcgcagcaggag
ctgctacaggccaagctggagcagctgggccccggcgagcccccgcctgtgctgctcctg
caggacgatcgccactccacgtcgtcctcggagcaggagcgagaggggggcaggacgccc
acgctggagatccttaggactcacatctcgggaatcttccgccccaagttctcgctcccg
ccaccgctgcagctcgtccctgaggtgcagaagccgctccacgagcagctgtggtaccac
ggggccatcccacgggccgaggtggctgagctgctgacgcactgcggggacttcctggtg
cgggagagccagggcaagcaggaggccgtgctgtcggtgctgtgggacggcctgccccgc
cacttcatcatccagtcctcggacaacctgtaccgactggaaggggacggttttcccagc
atccccttgctcatcgaccatctgctgcgatcccagcagcccctgaccaagaagagtggt
gtggtcctgcgcagggccgtgcccaaggacaagtgggtgctgaagcacgaggacctggtg
ctgggtgagcagatcgggcgggggaacttcggggaagtgttcagcggccgcctgcgagct
gacaacaccctggtggccgtgaagtcctgccgtgagaccctcccgcccgacctcaaggcc
aagtttctgcaggaagcgaggatcctgaagcagtacagccaccccaacatcgtgcgcctc
attggcgtctgcacccagaagcagcccatctacatcgttatggagctcgtgcaggggggc
gacttcctgaccttcctccggacggagggaggccgcctgcgggtgaagactctgctgcag
atggtgggcgacgcggcggcgggcatggagtacctggagagcaagtgctgcatccatcgg
gacctggctgctcgcaactgcctggtgacggagaagcatgtcctgaagatcagcgacttt
gggatgtcccgggaggaagccgacgggatctacgcagcctcgggcggcctcagacaggtg
cccgtgaagtggacggctcccgaggcccttaactatggccgctactcctcggagagtgac
gtgtggagctttggcatcctgctatgggagaccttcagcctgggggcctccccgtacccc
aacctcagcaaccagcagacccgggagtttgtggaaaaggggggccgcctgccctgccca
gagctgtgccctgacgccgtgttcaggctcatggagcagtgctgggcccatgagcccggg
cagcggcccaacttcagcaccatataccaggagctgcaaagcatccgcaggcggcatcgg
tga

DBGET integrated database retrieval system