KEGG   Oryctolagus cuniculus (rabbit): 100338868
Entry
100338868         CDS       T03373                                 
Symbol
UBE3B
Name
(RefSeq) ubiquitin protein ligase E3B
  KO
K10588  ubiquitin-protein ligase E3 B [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100338868 (UBE3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100338868 (UBE3B)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100338868 (UBE3B)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100338868 (UBE3B)
SSDB
Motif
Pfam: HECT IQ
Other DBs
NCBI-GeneID: 100338868
NCBI-ProteinID: XP_008249581
Ensembl: ENSOCUG00000013932
LinkDB
Position
Un
AA seq 1070 aa
MFTVSQTSRAWFIDRARQAREERLVQKERERAVVAIQAHVRSFLCRRRLQRDIRKEIDEF
FKADDAGSSRRSALCIFKIARKLLFLFRIKEDDERFQKLCRSILSSMEAESEAKVWYVSL
ALSKDLTLLWIKQIKDILWYCCEFLEQLKPEILQASRLVTLYLTMLVTFTDTATWKILRG
KGESLRPAMNHMCANIMGHLNQRGFYPVLQVLLTRGLARPRPCLSKGTLTAAFSLALRPV
IAAQFSDNLIRPFLIHIMSVPALVTHLGTVTPERLTVLESHDMLRKFILFLRDKDRCRDV
CESLEGCHTLCLMGNLLHLGSRSPRVLEEETDGFVSLLTQMLCYCQKYVAQKKSNLTHWH
PVLGWFSQSVDYGLNESMHLITKQLQFLWGVPLIRIFFSDILSKKLLENQEPAHAQPAAA
APQNVLPVKSLLKRAFQKSASVRNILRPVGGRRVDSAEVQKVCNICVLYQTSLTTLTQIR
LQILTGLTYLDDLLPKLWAFICELGPHGGLRLFLECLNNDTEESKQLLAMLMLFCDCSRH
LITILDDIEVYEEQISFKLEELVTISSFLNSFVFKMIWDGIVETAKGETRELFQSVHGWL
MVLYERDCRRRFAPEDHWLRKDLKPSVLYQELDKDRKRAQLILQYIPHVVPHKNRVLLFR
NMVTKEKEKLGLVETSSASPHVTHITIRRSRMLEDGYEQLRQLSQHAMKGVIRVKFVNDL
GVDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHENYLQLFEFV
GKMLGKAVYEGIVVDVPFASFFLSQLLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDG
DIADLGLTLSYDEDVMGQLVCHELIPGGKTIPVTNENKISYIHLMAHFRMHTQIKNQTAA
LISGFRSIIRPEWIRMFSAPELQRLISGDNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWD
ILASDFTPDERAMFLKFVTSCSRPPLLGFAYLKPPFSIRCVEVSDDQDTGDTLGSVLRGF
FTIRKREPGGRLPTSSTCFNLLKLPNYSKKGVLREKLRYAISMNTGFELS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgttcactgtgtctcagacctccagagcgtggttcatcgaccgggcccgccaggcgcgg
gaagagcggctggtgcagaaggagcgggaacgtgcagtcgtggccatccaggcgcacgtg
cggagctttctctgccggcgtcgcctgcagcgagacatcaggaaagagatcgacgagttt
tttaaagcagatgacgctgggtccagtagaagaagtgcactttgtatttttaagattgcc
aggaaactgctgttcttattcagaattaaagaggatgatgagagattccagaagctgtgt
cgcagcatcctgagcagcatggaggccgagagcgaagctaaggtgtggtatgtgtccctg
gctctttccaaggatctcaccctcctgtggattaagcagatcaaggacattctgtggtac
tgctgtgagtttcttgagcagctcaagcctgaaatcctgcaggcctccaggctcgtcacc
ctgtacctcaccatgctcgtcaccttcacagacaccgcgacgtggaaaatcctgcgggga
aaaggtgagagccttcggccggccatgaaccacatgtgtgcgaatataatgggacacctc
aaccagcgcgggttttaccctgtgctgcaggtgttgttgacgcgaggcctggcgagaccg
cggccttgcctgtcgaaaggcactttgacggcggccttttccctggcactgcgccccgtg
attgctgcccagttttcagacaatctgattcggccattcctcatccatatcatgtccgtg
cctgcccttgtgacccacctcggcacggtgaccccggagcgtctcactgttttagaatct
catgacatgcttcgaaaattcatcctattcctaagagacaaggatcgatgccgtgacgtc
tgtgagagtttagagggatgccataccctctgtctgatgggcaacctcctgcacctgggc
tcccgcagcccccgcgtgctggaggaggagacggacggctttgtgagtctgctcacccag
atgctgtgctactgccagaagtacgtggcccagaagaagtccaacctgacgcactggcac
cctgtcctcggctggttctcccaatccgtggattacggcctgaacgagtcaatgcacttg
atcaccaagcagctgcagttcctgtggggggtgcccctcatccgcatcttcttcagcgac
atcctgagcaagaagctgctggagaaccaggagccggcccacgcacagccggcggcggcg
gcgccgcaaaacgtgcttccggtgaagagtctcctgaagcgtgcgtttcagaagtctgcg
tcggttcggaatattctcaggcccgtcgggggcaggcgcgtcgactctgcggaagtacag
aaggtttgcaacatctgcgtcctctaccagacctcgctgaccacgctcacccagatccgc
ctgcagatcctcacaggtctcacttaccttgatgacctgctacccaaactgtgggcattt
atctgtgagctagggccccacggagggctcaggctcttcctggagtgcctgaacaatgac
accgaggagtccaagcagctcctggccatgctgatgctgttctgtgactgctcccggcac
ctcatcaccatcctcgatgacattgaggtttatgaagagcagatttccttcaagctggaa
gagctggtcaccatctcctctttcctgaactcctttgtgttcaagatgatctgggatgga
atcgtagagaccgccaagggcgagacgcgggagctgttccagtctgtccacgggtggctg
atggtgctgtacgagcgggactgccggcggcgcttcgcccccgaggaccactggctgcga
aaggatctcaaacctagcgtgctctaccaagaactcgacaaggacaggaagcgggcacag
ctgatcctgcagtacatccctcacgtggttccgcacaaaaacagagttctcctgttccgc
aacatggttaccaaggagaaggagaagctggggcttgtggaaaccagctccgcctcccca
cacgtcactcacatcactatccgcaggtcccggatgttggaggacggctacgagcagctg
cggcagctctcccagcacgccatgaagggcgtgatccgcgtgaagtttgtcaacgacctc
ggggtggacgaggcgggcatcgatcaagacggcgtcttcaaggagttcctggaagagatc
atcaagagggtctttgacccggcgctcaacctcttcaagaccaccagtggggacgagagg
ctgtacccctcgcccacgtcctacatccacgagaattacctgcagctcttcgagttcgtg
gggaagatgctcggaaaggcagtgtatgaggggatcgtggtcgacgtgcccttcgcctcc
ttcttcctgagccagctgctcggacaccaccacagtgtcttctacagctccgtggatgaa
cttccttctctggactcggagttctataaaaacctcacctccattaagcgctacgatggg
gacatcgccgacctgggcttgacgctgtcttacgacgaggacgtcatgggccagctcgtg
tgccatgagctgattcctggagggaagaccatccctgtcacaaatgagaacaaaattagc
tacatccatttgatggctcattttcgaatgcacactcaaataaaaaaccagacagctgcc
ctcattagcggcttccggtccatcatcagacccgagtggatccgaatgttctcagccccc
gagctgcagcggctcatctccggagacaatgctgaaatcgacctggaagatctcaagaag
cacacggtgtactacggcggttttcacgggagccacagagtgatcatctggctctgggat
atcctggcctccgacttcacgccggacgagagagccatgttcctgaagtttgtgacgagc
tgctccaggcccccgctcctgggcttcgcctacctcaagcctccgttctccatccgctgt
gtggaagtgtcggatgatcaggacaccggggacaccctgggcagtgtcctccggggcttc
ttcaccattcgcaagcgcgagccgggcggccggctgcccacctcctccacctgcttcaac
ctgctcaagctgcccaactacagcaagaagggcgtgctccgggagaagctgcgctacgcc
atcagcatgaacacgggcttcgagctctcctag

DBGET integrated database retrieval system