Oryctolagus cuniculus (rabbit): 100339119 Help Entry 100339119         CDS       T03373                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04621   NOD-like receptor signaling pathway ocu05012   Parkinson disease ocu05132   Salmonella infection ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100339119  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100339119   09164 Neurodegenerative disease    05012 Parkinson disease     100339119   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100339119  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ocu03110]     100339119 Chaperones and folding catalysts [BR:ocu03110]  Protein folding catalysts   Protein disulfide isomerase    100339119 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 OST3_OST6 AhpC-TSA Thioredoxin_2 Thioredoxin_9 Glutaredoxin Thioredoxin_7 HyaE Redoxin Motif Other DBs NCBI-GeneID:  100339119 NCBI-ProteinID:  XP_002708129 Ensembl:  ENSOCUG00000030643 UniProt:  A0A5F9CW87 LinkDB All DBs Position 1:17112115..17123038 Genome browser AA seq 105 aa AA seqDB search MVKQIESKSAFQEVLDSAGDKLVVVDFSATWCGPCKMIKPFFHALSEKFNNVVFIEVDVD DCQDIAAECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELL NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgaaagcaagtctgcttttcaggaagtcttggacagcgcaggagat aagctcgtcgtggtggacttctcagccacgtggtgtgggccctgcaaaatgatcaaacct ttctttcacgccctctctgaaaaatttaataacgtggtgttcattgaagtagacgtggat gactgccaggatattgctgcagagtgtgaagtcaaatgcatgccgaccttccagtttttt aaaaaggggcaaaaggtgggtgaattttctggagctaataaggaaaagcttgaagccacc attaatgaactactctaa

DBGET integrated database retrieval system