KEGG   Oryctolagus cuniculus (rabbit): 100339215
Entry
100339215         CDS       T03373                                 
Symbol
GDF7
Name
(RefSeq) growth differentiation factor 7
  KO
K20013  growth differentiation factor 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100339215 (GDF7)
   04390 Hippo signaling pathway
    100339215 (GDF7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100339215 (GDF7)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100339215 (GDF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100339215 (GDF7)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100339215 (GDF7)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 100339215
NCBI-ProteinID: XP_008253046
LinkDB
Position
2:169747815..169758421
AA seq 380 aa
PGAARRAAGSSFRNGSVVPHHFMMSLYRSLAGRVQAGVAAASVSGHSRADTITGFADQAT
QDESAAETGQSFLFDVSSLSDADEVVGAELRVLRRQSPEPDLGTATRPPTLLLLSTCPGA
ARAPRLLHSRAAEPLDGARWEVFDVADAVRRHRRESRATRAFCLLLRAVAGPGRSPLAVR
LLGFGWRGGAAAEERALLVVSSRTQRKESLFREIRAQARALGASLAAEPPPDPGPGGASS
RVAIGGRRRRRTALTGTRAAQGSGGGAGRGHGRRSRSRCSRKPLHVDFKELGWDDWIIAP
LDYEAYRCEGVCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDA
ANNVVYKQYEDMVVEACGCR
NT seq 1143 nt   +upstreamnt  +downstreamnt
ccgggcgctgcgcgccgcgccgcgggctccagcttcaggaacggctcggtggtgccgcac
cacttcatgatgtcgctctaccggagcctggccgggagggttcaggccggggtggccgcc
gcctccgtctcgggccacagccgcgcggacaccatcaccggcttcgcggaccaggctacc
caagacgagtcggcggccgagaccggccagagcttcctattcgacgtgtccagtctttcc
gacgccgacgaggtggtgggcgccgagctgcgcgtgctgcgtcgccagtcgccggagccc
gaccttggcactgcgacgcgtccgccgacactgctgctactgtccacgtgcccgggcgcc
gcccgcgccccgcgcctgctgcactcgcgggccgccgagcccttggacggcgcgcgttgg
gaggtgttcgacgtggccgacgccgtgcggcgccaccgccgggagtcgcgagccacccgc
gcgttctgtctcttgctgcgcgcagtggccggcccggggcggagcccgttggcagtgagg
ctgctgggcttcggctggcgcggcggcgcggcggcggaggagcgtgcgttgctcgtagtc
tcctcccgcacgcagaggaaggagagcctgttccgggagatccgcgcccaggcccgcgcg
ctcggggcctctctggccgcggaaccgccgccggacccgggacctggcggcgcgtcgtcc
agggtggccatcggcggtcgcaggcggcggcggacggcactaaccgggacgcgcgcggcg
cagggcagcggcgggggcgcgggccggggccatgggcgcaggagccggagccgctgtagc
cggaaaccgctgcacgtagacttcaaggagctgggctgggacgattggatcatcgcgccg
ctggactacgaggcgtaccgctgcgagggcgtgtgcgacttcccgctgcgctcgcacctc
gagcccaccaaccacgccatcattcagacgctgctcaactccatggcgccggatgcggcg
ccggcctcctgctgcgtgcccgcgcgcctcagccccatcagtatcctctacatcgacgcc
gccaacaacgtggtctacaagcagtacgaggacatggtggtggaggcgtgcggctgcagg
tag

DBGET integrated database retrieval system