KEGG   Oryctolagus cuniculus (rabbit): 100339322
Entry
100339322         CDS       T03373                                 
Symbol
IL17A
Name
(RefSeq) interleukin 17A
  KO
K05489  interleukin 17A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04657  IL-17 signaling pathway
ocu04659  Th17 cell differentiation
ocu04936  Alcoholic liver disease
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100339322 (IL17A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100339322 (IL17A)
   04657 IL-17 signaling pathway
    100339322 (IL17A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100339322 (IL17A)
   05321 Inflammatory bowel disease
    100339322 (IL17A)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100339322 (IL17A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100339322 (IL17A)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100339322 (IL17A)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 100339322
NCBI-ProteinID: XP_002714544
Ensembl: ENSOCUG00000004270
UniProt: G1SLF2
LinkDB
Position
12:41693016..41696263
AA seq 153 aa
MSLGRISSVSLLLLLCLVATVKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRR
PSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVL
RRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtcgcttgggaggatttcatctgtgtcactgctgctgctgctgtgtttggtggctact
gtgaagaatggaatagcaatgccgcgaaatccaggatgtccaaatgctgaggacaagaac
ttcccccagaatgtaaaagtcagcctgaacatccttaacaagagtgtaaattcccgaagg
ccttcagactactacaatcgatctacttcaccttggactctccaccgcaacgaggatcgt
gagagatatccctctgtgatctgggaggccaagtgccgccacttgggctgtgtcaatgct
gaagggaatgaggaccaccacatgaactctgtcccaatccagcaagagatcctggtccta
cgcagggagtcccagcactgcccacactcattccggctggagaagatgctggtggctgta
ggatgcacctgtgtaacccccatcatccatcacatggcctaa

DBGET integrated database retrieval system