KEGG   Oryctolagus cuniculus (rabbit): 100339381
Entry
100339381         CDS       T03373                                 
Symbol
PCNA
Name
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03030  DNA replication
ocu03410  Base excision repair
ocu03420  Nucleotide excision repair
ocu03430  Mismatch repair
ocu04110  Cell cycle
ocu04530  Tight junction
ocu05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100339381 (PCNA)
   03410 Base excision repair
    100339381 (PCNA)
   03420 Nucleotide excision repair
    100339381 (PCNA)
   03430 Mismatch repair
    100339381 (PCNA)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100339381 (PCNA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100339381 (PCNA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100339381 (PCNA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100339381 (PCNA)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100339381 (PCNA)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    100339381 (PCNA)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100339381 (PCNA)
   MMR (mismatch excision repair)
    Other MMR factors
     100339381 (PCNA)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    100339381 (PCNA)
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Rad9 Hus1 FmdE
Other DBs
NCBI-GeneID: 100339381
NCBI-ProteinID: XP_017197251
Ensembl: ENSOCUG00000004059
UniProt: G1SKZ3
LinkDB
Position
4:complement(11721716..11726405)
AA seq 261 aa
MFEARLVQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtttgaggcacgcctggtccagggctccatcctgaagaaggtgctggaggcactcaag
gatctcatcaacgaggcctgctgggacatcagctcgggcggcgtgaacctgcaaagcatg
gactcgtcccacgtctccctggtgcagctcaccctgcgctccgagggcttcgacacgtac
cgctgcgaccgcaacctggccatgggcgtgaacctcaccagcatgtccaaaatactaaaa
tgtgccggcaacgaagacatcattacactgagggctgaagataatgcggacaccttggcg
ctagtatttgaagcaccaaatcaagagaaagtttcagactatgaaatgaaattaatggac
ttagatgttgaacagcttggaattccagaacaagagtacagctgtgtagtaaaaatgcct
tctggtgaatttgcacgtatatgccgagacctcagccatattggagatgccgttgtaata
tcctgtgcaaaagatggggtgaagttttccgccagtggagaactgggaaatggaaacatt
aagttgtcacaaacgagcaatgttgataaagaagaggaagctgttaccatagagatgaat
gagccagtgcaactaacttttgcactgaggtacctaaacttctttacaaaagccactccg
ctttctcctacagtaacgctcagtatgtctgcagatgtacctcttgttgttgagtataaa
attgccgacatgggacatttaaagtattatttggcccccaagatcgaggatgaagaagga
tcttag

DBGET integrated database retrieval system