KEGG   Oryctolagus cuniculus (rabbit): 100339463
Entry
100339463         CDS       T03373                                 
Symbol
SKP1
Name
(RefSeq) S-phase kinase associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
ocu04310  Wnt signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04710  Circadian rhythm
ocu05132  Salmonella infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100339463 (SKP1)
   04120 Ubiquitin mediated proteolysis
    100339463 (SKP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100339463 (SKP1)
   04350 TGF-beta signaling pathway
    100339463 (SKP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100339463 (SKP1)
   04114 Oocyte meiosis
    100339463 (SKP1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100339463 (SKP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100339463 (SKP1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100339463 (SKP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100339463 (SKP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100339463 (SKP1)
   04121 Ubiquitin system [BR:ocu04121]
    100339463 (SKP1)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100339463 (SKP1)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    100339463 (SKP1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     100339463 (SKP1)
   Cul7 complex
     100339463 (SKP1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     100339463 (SKP1)
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100339463 (SKP1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 100339463
NCBI-ProteinID: XP_002710256
Ensembl: ENSOCUG00000022505
UniProt: G1TTU6
LinkDB
Position
3:complement(16978020..16994063)
AA seq 163 aa
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgccttcaataaagttgcagagttctgatggagagatttttgaagttgatgtagaaatt
gccaaacagtctgtgactatcaagaccatgttggaagatttggggatggatgatgaagga
gacgatgacccggttcctctaccaaatgttaatgcagcaatattaaaaaaggtcattcag
tggtgcacccaccacaaggatgaccctcctccccctgaagacgatgagaacaaagaaaag
cgaacggatgatatccctgtttgggaccaggaattcctgaaagttgaccaaggaacactt
tttgagcttattctggctgcaaactacttagacatcaaaggtttgctggacgttacgtgc
aagactgttgccaatatgatcaaggggaagactcctgaggagattcgcaagaccttcaac
attaagaatgactttactgaagaagaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

DBGET integrated database retrieval system