KEGG   Oryctolagus cuniculus (rabbit): 100339509
Entry
100339509         CDS       T03373                                 
Symbol
PIAS1
Name
(RefSeq) protein inhibitor of activated STAT 1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04630  JAK-STAT signaling pathway
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100339509 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100339509 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100339509 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100339509 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100339509 (PIAS1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-
     100339509 (PIAS1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100339509 (PIAS1)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    100339509 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 100339509
NCBI-ProteinID: XP_008267065
Ensembl: ENSOCUG00000000618
LinkDB
Position
17:complement(4347986..4488831)
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRTYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVPASYNGVDGCLSSTLEHQVTSHHSSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHPVASRSGTDTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgagctccaa
gtactgttgggctacgctgggagaaacaagcacggacgcaaacacgaacttcttacaaaa
gccctgcatttgctaaaggctggctgtagtcctgccgtacaaatgaaaattaaagaactc
tacaggcggcggttcccccagaaaatcatgacgcctgcggacttatccatcccaaacgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacagctcacttacgat
ggtcaccctgcatcatcaccattactccctgtttctcttctgggacctaaacacgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgcattgacaccacaacaagtgcaacag
atcagtagttccatggatatttcggggaccaaatgtgacttcacagtgcaggtccagtta
aggttttgtttatcagaaaccagttgcccgcaggaagatcacttcccacctaatctttgt
gtgaaagtgaatacaaaaccttgtagccttccaggttaccttccacctactaaaaatggc
gtggaaccaaagcgacccagccgaccaattaacataacttcacttgtccggttgtccaca
acagtaccaaacaccattgttgtctcttggactgcagaaattggaagaacctattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaataaaagagaaattgactgcagatcca
gacagtgaaatagccacaaccagcctaagggtttctctactatgtccactcggtaagatg
cggctgacgattccgtgccgggcccttacctgctcccatctgcagtgctttgatgcaact
ctgtatattcagatgaacgagaaaaaaccaacctgggtttgtcctgtgtgtgataagaag
gctccgtatgaacaccttattatagatggcttatttatggaaatcctaaaatactgtaca
gactgtgatgaaatacaatttaaggaggatggctcttgggcacccatgagatccaaaaag
gaagtacaggaagttcctgcctcttacaacggagtcgacggatgcctgagctccacattg
gagcatcaggtgacttcccaccactcgtcctcaaataaaaacaagaaagtcgaggtgatt
gatctaaccattgacagctcatctgacgaggaggaggaagagccatctgccaagaggacc
tgcccttccctgtcccccacgtcgccactcaataataaaggcattttaagtcttccacat
caagcatctccagtatctcgcacccccagccttcctgctgtggacacaagctacatcaac
acgtccctcatccaagactacaggcatcctttccacatgacgcccatgccttacgacctg
caaggattagatttcttccctttcttatcaggagacaatcagcattacaacacctcgctg
ctggccgccgccgccgccgccgtctcggacgatcaggacctcctgcactcctcgcggttt
ttcccgtatacctcctcgcagatgtttctcgatcagctgagtgcaggaggcagcacctcg
ttgccaaccaccaacgggagcagcagtggcagtaacagcagcctcgtgtcctccaacagc
ctgcgggagagccacagccacccggtggccagcaggagcggcacggacacggcgtccatc
ttcggcatcatcccagacataatctccttggactga

DBGET integrated database retrieval system