KEGG   Oryctolagus cuniculus (rabbit): 100339537
Entry
100339537         CDS       T03373                                 
Symbol
CCR6
Name
(RefSeq) C-C motif chemokine receptor 6
  KO
K04181  C-C chemokine receptor type 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100339537 (CCR6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100339537 (CCR6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100339537 (CCR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100339537 (CCR6)
   04030 G protein-coupled receptors [BR:ocu04030]
    100339537 (CCR6)
   04050 Cytokine receptors [BR:ocu04050]
    100339537 (CCR6)
   04090 CD molecules [BR:ocu04090]
    100339537 (CCR6)
Cilium and associated proteins [BR:ocu03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   100339537 (CCR6)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100339537 (CCR6)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100339537 (CCR6)
CD molecules [BR:ocu04090]
 Proteins
  100339537 (CCR6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx DUF621
Other DBs
NCBI-GeneID: 100339537
NCBI-ProteinID: XP_002723912
Ensembl: ENSOCUG00000025779
LinkDB
Position
Un
AA seq 415 aa
MCHGACFWIHAVLCRRALAAGPCAPLPLRGQRLRPRSSTTMGEEAVNSSDAYYFGEDYPD
FANTSYYPVDDGALVCSLQEVRDFSRVFVPIAYSLICVFGLLGNTLVVVTFACYKKAKSM
TDVYLLNMALADILFVLTLPFWAVSHAAGAWVFSGALCKLMKGIYAINFNCGMLLLTCVS
LDRYVAIVQATRSFRLRSRTLARSKVVCLAVWLVAVVTSSSTFTFNQKYELQGREVCEPR
YHAVSEPVVWKLLVLGLELLFGFFVPLLCMVFCYAFIIRTLVQAQNSKRHKAIRVIIAVV
LVFLACQIPHNVVLLVTAANLGRLDRSCASERLIGYTKNVTEVLAFLHCCLNPVLYAFVG
HRFRNYFLKVARDLWCARRKHQALGLSCSRVYSETCPARPASETVDNDNVSSFTM
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgtgccacggagcctgcttctggattcacgccgttctctgccggcgagccctagcggct
ggcccgtgtgcgccccttcctctccgaggccagcgtctccggcccagatccagcaccacg
atgggcgaggaagccgtgaactccagtgacgcctactatttcggggaagactaccccgac
ttcgccaacacctcctactacccggtggacgacggcgccctggtctgctccctgcaggag
gtccgggacttctccagggtgtttgtgccgatcgcctactccttgatctgcgtctttggc
ctcctgggcaacaccctggtggtggtcaccttcgcctgctacaagaaggccaagtccatg
accgacgtgtacctcctgaacatggccctggccgacatcctcttcgtgctcacgctgccg
ttctgggccgtcagccacgcggccggcgcctgggtcttcagcggcgccctgtgcaagctg
atgaaaggcatctacgccatcaacttcaactgcgggatgctgctgctcacctgcgtcagc
ctggaccgctacgtggccatcgtgcaggccacccgctccttccggctgcgctccaggacc
ctggcgcgcagcaaggtcgtctgcctggccgtgtggctcgtggccgtcgtcacctccagc
tccaccttcaccttcaaccagaagtacgagctgcagggccgcgaggtctgcgagccccgg
taccacgcggtctcggagcccgtcgtgtggaagctgctggtgctggggctcgagctgctc
ttcggcttcttcgtcccgctgctctgcatggtcttctgctatgcgttcatcatcaggacg
ctggtgcaggcccagaactccaagaggcacaaggccatccgcgtcatcatagccgtggtc
ctggtgttcctggcctgtcagatcccccacaacgtggtgctgctcgtcacggccgccaac
ctgggccgcctggaccggtcctgcgccagcgagaggctgatcggctacaccaagaacgtc
accgaggtcctggccttcctccactgctgcctcaaccccgtgctctacgccttcgtcggc
cacaggttcaggaactacttcctgaaggtcgcgagggacctgtggtgcgcgaggaggaag
caccaggcgctcggcttgtcctgctccagggtgtactcggagacctgccccgccaggccc
gccagcgagaccgtggacaacgacaacgtgtcgtctttcaccatgtga

DBGET integrated database retrieval system