KEGG   Oryctolagus cuniculus (rabbit): 100339570
Entry
100339570         CDS       T03373                                 
Symbol
IL17F
Name
(RefSeq) interleukin 17F
  KO
K05494  interleukin 17F
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04657  IL-17 signaling pathway
ocu04659  Th17 cell differentiation
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100339570 (IL17F)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100339570 (IL17F)
   04657 IL-17 signaling pathway
    100339570 (IL17F)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100339570 (IL17F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100339570 (IL17F)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100339570 (IL17F)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 100339570
NCBI-ProteinID: XP_008261263
Ensembl: ENSOCUG00000004271
UniProt: G1SLF3
LinkDB
Position
12:complement(41737479..41744074)
AA seq 163 aa
MTMKMMNDTAMVKSLLLLILGLTLLREGMARKNPKVEDATLLKPGNCPPLEDNSVRVDIR
ILSQNHGVPITHDFQNRSISPWDYNITRDPHRFPSEIAEARCRHSGCINAQGEEDSSMNS
VPIQQEFLVLQREPQGCSRSFRLEKVWVTVGCTCVTPIVRYAA
NT seq 492 nt   +upstreamnt  +downstreamnt
atgacaatgaagatgatgaatgacacagccatggtcaagtctctgctgctgttgattttg
gggctcaccctcctgagggaggggatggctcggaaaaatcccaaagtggaggatgctacc
ctcctaaagcctgggaattgtccccctctggaggacaacagtgtgagagttgacattcgc
atcctcagtcaaaaccacggagttcccatcacacatgacttccagaaccgctccatctcc
ccctgggattacaacatcacccgggacccccatcggttcccctcggagatcgcagaggca
cgatgcaggcactcaggctgcatcaacgcccagggggaggaagacagctccatgaactcc
gttcccatccagcaagagttcctggttctccagagggagccccagggctgctctcgatcc
ttccggctggagaaggtgtgggtgaccgttggctgcacctgtgtcacccccatcgtccgc
tatgcagcctga

DBGET integrated database retrieval system