KEGG   Oryctolagus cuniculus (rabbit): 100339678
Entry
100339678         CDS       T03373                                 
Symbol
TAB3
Name
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 3
  KO
K12793  TAK1-binding protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04936  Alcoholic liver disease
ocu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100339678 (TAB3)
   04668 TNF signaling pathway
    100339678 (TAB3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100339678 (TAB3)
   04657 IL-17 signaling pathway
    100339678 (TAB3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100339678 (TAB3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100339678 (TAB3)
SSDB
Motif
Pfam: CUE zf-RanBP
Other DBs
NCBI-GeneID: 100339678
NCBI-ProteinID: XP_017205325
Ensembl: ENSOCUG00000007836
LinkDB
Position
X:complement(16918869..16998278)
AA seq 717 aa
MAQSNPQLDIQVLHDLRQRFPEIPEVVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
PDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHTAGKQLICL
VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTAMNPSAMQGPSPPPP
PPPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSS
SGRQTPQNTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQ
CPSPFSSPQHQVQPSQLGHPSSHVFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAYLPYTA
SSLPKGSMKKIEITVEPSQRPGTAITRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGIP
SQPKPPFSVNPVYITYTQPTGPSCAPSPSPRVIPNPTTVFKITVGRTTTENLLNLVDQEE
RSAAPEPIQPISVIPGSGGEKGSHKYQRSTSSGSDDYAYTQALLLHQRARMERLAKQLKL
EKEELERLKAEVNGMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEV
DLLQSRGNFDPKAMNNFYDNIEPGPIVPPKPSKKDSSDPCTIERKARRISVTSKVQADVH
DTQAAAAEEHLTGSRQSPRPQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggcgcaaagcaatccacagcttgatattcaggttctccatgatctccgacagcgtttc
cctgagattccagaggttgtggtgtctcagtgcatgttacagaataacaacaatcttgaa
gcctgttgccgagccctttcccaggagagtagcaaatacttatatatggaataccatagt
ccagatgacaataggatgaatagaaatcgtcttttgcatattaacctgggtatccattct
cctagtagctaccacccaggagatggagctcaacttaatggtggtagaacactggtacac
agctcaagtgatggacatattgatccacagcatacagcaggtaaacagctgatatgttta
gttcaggaaccacactcagctccagctgttgtggctgctactcccaactacaatccattt
tttatgaatgaacaaaacagaagtgcagctactcctccttcacagccacctcaacagcca
tcttccatgcaaacagcaatgaatccatctgctatgcaagggccttcaccaccaccacca
ccgcctccttcctacatgcacatacctcggtatagtacaaatccaattactgttacagta
tcccagaatctcccttctggacagactgtacccagagctttacagattcttccacaaatt
ccgagcaatctctatgggtcacctggttctatttatattagacagacatctcagagttca
tcaggaagacaaactcctcagaatacgccatggcagtcctcaccacagggcccagtgcct
cattatagccaacgtcctttacctgtttatccacaccaacaaaactatcagccttctcag
tattctcccaaacaacagcagatccctcaatctgcctaccattccccacctccttctcag
tgtccttcacccttcagctcgccacagcatcaagtgcaaccttcccagttgggccaccca
agctcccacgtctttatgccacctagtccttcaactactccaccccatccatatcaacaa
ggacctcctagctatcagaaacagggaagtcattcagtagcctatctcccatacacagcg
tctagcttacccaaaggttctatgaagaagatagaaattacagttgaaccttctcaaaga
cctgggacagcgattactaggagtccttcacccatcagtaatcaaccgtctcctcggaat
cagcactcactgtacacagccaccacgccaccttcaagttctccttcaagagggatacct
agtcaaccaaaacctccgtttagtgttaatcctgtgtatattacatatacacagccaact
ggaccttcatgtgctccatcgccgtctcctcgggtgataccaaacccaactacagttttt
aaaatcacggtaggccgaacaacgactgaaaatcttctaaatttagtggaccaagaagag
cgctctgcagcaccagaacctattcagcccatttcagtgataccaggctctgggggagaa
aagggaagccataagtatcagaggagcactagttctggatcagacgactatgcgtataca
caagccttgctgttacatcagcgagcaaggatggagaggttagcaaagcagttgaaactt
gagaaagaggagctagagcggttgaaggctgaagttaacggtatggagcatgacctgatg
cagagacggctcagaagagtcagctgcaccactgcaatcccaacccctgaggaaatgaca
agattgagaagcatgaacagacaactccagataaatgttgactgtacactgaaagaagtt
gacctccttcaatctagaggaaactttgatccaaaagccatgaataatttttatgacaac
atagaacccggcccaattgtaccacccaaaccatctaaaaaagactcctcggacccctgc
acaattgagagaaaagctcgaagaattagtgtgacctccaaagtacaggcagatgtccat
gatacccaggcagcagctgcagaggagcatctaactggctccagacaaagccctcggcca
cagccccgagatgaagactatgaaggggctccgtggaattgtgacagctgcaccttcctc
aaccacccagcgctaaatcgctgtgagcagtgcgagatgccacggtacacttga

DBGET integrated database retrieval system