KEGG   Oryctolagus cuniculus (rabbit): 100339741
Entry
100339741         CDS       T03373                                 
Symbol
FYN
Name
(RefSeq) FYN proto-oncogene, Src family tyrosine kinase
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04360  Axon guidance
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04520  Adherens junction
ocu04611  Platelet activation
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04725  Cholinergic synapse
ocu05020  Prion disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100339741 (FYN)
   04071 Sphingolipid signaling pathway
    100339741 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100339741 (FYN)
   04520 Adherens junction
    100339741 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100339741 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    100339741 (FYN)
   04660 T cell receptor signaling pathway
    100339741 (FYN)
   04664 Fc epsilon RI signaling pathway
    100339741 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    100339741 (FYN)
  09158 Development and regeneration
   04360 Axon guidance
    100339741 (FYN)
   04380 Osteoclast differentiation
    100339741 (FYN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100339741 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100339741 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100339741 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100339741 (FYN)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100339741 (FYN)
Protein kinases [BR:ocu01001]
 Non-receptor tyrosine kinases
  SRC family
   100339741 (FYN)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100339741 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    100339741 (FYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 ABC1 SH3_3 zf-RING_14 Haspin_kinase
Other DBs
NCBI-GeneID: 100339741
NCBI-ProteinID: XP_002714971
Ensembl: ENSOCUG00000015784
UniProt: G1TA73
LinkDB
Position
12:complement(99425906..99656341)
AA seq 537 aa
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggacaaagaagcaacaaaactgactgaggagagggacggc
agcctgaaccagagctccggctaccgctatggcacagaccccacccctcagcactaccca
agcttcggcgtgacctccatccccaactacaacaacttccacgcggctggtggccagggg
ctcaccgtcttcgggggtgtgaactcttcgtctcacactgggaccttgcgcacaagagga
gggacaggagtgacactgtttgtggccctctatgactacgaagcccggacggaagatgac
ctgagttttcacaaaggagaaaaatttcagatcctgaacagctcagaaggagactggtgg
gaagcccgctcgctgacgacgggagagacgggttacattcccagcaactatgtggctcca
gtcgactctatccaggcagaagagtggtactttggaaaactgggccggaaagatgcagag
cggcagcttttgtcctttggaaacccaagaggtacctttcttatccgcgagagtgaaacc
accaaaggtgcctattcactttctatccgtgattgggatgatatgaaaggagaccatgtc
aaacattataaaatccgcaagcttgacaatggtggatactacatcaccacccgggcccag
tttgaaacccttcagcagctcgtacagcattactcagagagagccgcaggtctgtgctgc
cgcctagtagtgccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaacggaaacacaaaagtagccataaagact
ctcaagccaggcacgatgtccccagagtcgttcctcgaggaagcgcagatcatgaagaag
ctgaaacatgacaagctggtgcagctgtacgccgtggtgtccgaggagcccatctacatc
gtcaccgagtacatgaacaaaggaagtttacttgatttcttaaaagacggagaaggaagg
gccctgaagctaccaaacctggtggacatggcggcacaggtcgctgcaggaatggcttac
attgagcgcatgaattacatccacagagacctgcggtcagcaaacattctggtgggcaat
ggactcatatgcaagatcgccgacttcggattggcccggttgattgaagacaacgagtac
acagcacgacaaggcgccaagttccccatcaagtggacggcccccgaagccgccctgtac
gggagattcacgatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtc
accaaagggagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtggaa
cgcggctacaggatgccctgcccgcaggactgccccatctctctgcacgagctcatgatc
cactgctggaaaaaggaccccgaggagcgccccacttttgagtacttgcagagcttcctg
gaagactactttacggccacagagccccagtatcaacctggtgaaaacctctaa

DBGET integrated database retrieval system