KEGG   Oryctolagus cuniculus (rabbit): 100339873
Entry
100339873         CDS       T03373                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04145  Phagosome
ocu04148  Efferocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04517  IgSF CAM signaling
ocu04520  Adherens junction
ocu04530  Tight junction
ocu04613  Neutrophil extracellular trap formation
ocu04620  Toll-like receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu04932  Non-alcoholic fatty liver disease
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04972  Pancreatic secretion
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05100  Bacterial invasion of epithelial cells
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
ocu05415  Diabetic cardiomyopathy
ocu05416  Viral myocarditis
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100339873
   04014 Ras signaling pathway
    100339873
   04015 Rap1 signaling pathway
    100339873
   04310 Wnt signaling pathway
    100339873
   04370 VEGF signaling pathway
    100339873
   04071 Sphingolipid signaling pathway
    100339873
   04024 cAMP signaling pathway
    100339873
   04151 PI3K-Akt signaling pathway
    100339873
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    100339873
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100339873
   04148 Efferocytosis
    100339873
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100339873
   04520 Adherens junction
    100339873
   04530 Tight junction
    100339873
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100339873
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100339873
   04620 Toll-like receptor signaling pathway
    100339873
   04650 Natural killer cell mediated cytotoxicity
    100339873
   04662 B cell receptor signaling pathway
    100339873
   04664 Fc epsilon RI signaling pathway
    100339873
   04666 Fc gamma R-mediated phagocytosis
    100339873
   04670 Leukocyte transendothelial migration
    100339873
   04062 Chemokine signaling pathway
    100339873
  09154 Digestive system
   04972 Pancreatic secretion
    100339873
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100339873
  09158 Development and regeneration
   04360 Axon guidance
    100339873
   04380 Osteoclast differentiation
    100339873
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100339873
   05205 Proteoglycans in cancer
    100339873
   05208 Chemical carcinogenesis - reactive oxygen species
    100339873
   05203 Viral carcinogenesis
    100339873
   05231 Choline metabolism in cancer
    100339873
  09162 Cancer: specific types
   05210 Colorectal cancer
    100339873
   05212 Pancreatic cancer
    100339873
   05211 Renal cell carcinoma
    100339873
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100339873
   05163 Human cytomegalovirus infection
    100339873
   05167 Kaposi sarcoma-associated herpesvirus infection
    100339873
   05169 Epstein-Barr virus infection
    100339873
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100339873
   05135 Yersinia infection
    100339873
   05100 Bacterial invasion of epithelial cells
    100339873
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100339873
   05020 Prion disease
    100339873
   05022 Pathways of neurodegeneration - multiple diseases
    100339873
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100339873
   05418 Fluid shear stress and atherosclerosis
    100339873
   05415 Diabetic cardiomyopathy
    100339873
   05416 Viral myocarditis
    100339873
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100339873
   04933 AGE-RAGE signaling pathway in diabetic complications
    100339873
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100339873
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100339873
   04031 GTP-binding proteins [BR:ocu04031]
    100339873
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100339873
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    100339873
  Macropinocytosis
   Ras GTPases
    100339873
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100339873
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100339873
  Exosomal proteins of other body fluids (saliva and urine)
   100339873
  Exosomal proteins of colorectal cancer cells
   100339873
  Exosomal proteins of bladder cancer cells
   100339873
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100339873
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 100339873
NCBI-ProteinID: XP_051695035
Ensembl: ENSOCUG00000009956
LinkDB
Position
Unknown
AA seq 211 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVGETYGKDITSRGRDKPIADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtgggtaagacttgcctgctg
atcagctacacgaccaatgcgttccctggagagtacatccccactgtctttgacaactat
tctgccaatgttatggtagatggaaaaccagtgaatctgggcttatgggatacagccgga
caagaagattatgacaggttacggcccctgtcctacccacaaacagttggagaaacgtat
ggtaaggacattacgtccaggggcagagacaagccgattgccgacgtcttcttgatttgc
ttttcccttgtgagtcctgcgtcgtttgaaaatgtccgagcgaagtggtaccctgaagtg
cgacaccattgtcccaacacgcccatcatcctcgtgggaacgaaactggatcttcgggat
gataaagacacgattgagaaactgaaggagaagaagctgacacccatcacctacccgcag
ggcttggccatggccaaggagatcggtgctgtgaaatacctggagtgctcggccctcacg
cagcgaggcctcaagacagtgttcgacgaggcgatccgagcggtcctctgcccgcccccc
gtcaagaagaggaagaggaagtgcctgctgctgtga

DBGET integrated database retrieval system