KEGG   Oryctolagus cuniculus (rabbit): 100340021
Entry
100340021         CDS       T03373                                 
Symbol
EDA
Name
(RefSeq) ectodysplasin A
  KO
K05480  ectodysplasin-A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100340021 (EDA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100340021 (EDA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100340021 (EDA)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100340021 (EDA)
SSDB
Motif
Pfam: TNF Collagen
Other DBs
NCBI-GeneID: 100340021
NCBI-ProteinID: XP_002720109
Ensembl: ENSOCUG00000015594
LinkDB
Position
X:48233783..48591215
AA seq 388 aa
MGYPEVERREPLPAAAPRERGSQGCGCRGAPARAGEGNSCRLFLGFFGLSLALHLLTLCC
YLELRSELRRERGAESRLGGAGTSGTLSSTGGLDPDAPITRHLGQPSPQQQPLEPGETTL
SPDSQDGHQMALFNFFFPDEKSYSGEESRRVRRNKRSKSSEGADGPVKNKKKGKKAGPPG
PNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGVQGPSGAADKAGT
RENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFI
YSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVK
MVHADISINMSKHTTFFGAIRLGEAPAS
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgggctaccccgaggttgagcgcagggaacccctgcctgcggcagcgccaagggagcga
gggagccagggctgcggctgtcgcggggcccctgcccgggcaggcgaagggaacagctgc
cgactcttcctgggtttctttggcctctcgctggccctccacctgctgacgttgtgctgc
tacctagagttgcgctctgagttgcggcgggaacgcggagccgagtcccgccttggcggc
gcgggcacctctggcaccctgagcagcaccggtggcctcgaccccgacgctcccatcacc
cgccacctcgggcagccgtcccctcagcagcagcctttggaaccgggagaaaccacactc
tcccccgactcccaggacgggcaccagatggccctattcaatttcttcttccctgacgaa
aagtcatactctggagaggaaagtaggcgtgttcgccgcaataaaagaagcaaaagcagt
gaaggagcagatggtccagttaaaaacaagaaaaaaggaaagaaggcagggccacctggg
cccaatggccctccaggaccaccgggacctccagggccccaggggcccccaggaattcca
ggaattcctgggattccagggacaactgttatgggaccacccggtcctccaggtcctcct
ggtcctcaaggaccccctggtgtccagggaccctctggtgctgctgataaagctggaact
cgagaaaaccagccagctgtggtgcatctacagggccaggggtcggcaatccaagtcaag
aatgatctttcaggtggagtgctcaatgactggtctcgcatcactatgaaccccaaggtg
tttaagctacatccccgcagcggggagctggaggtactggtggacggcacctacttcatc
tatagtcaggtagaagtatactacatcaacttcactgactttgccagctatgaggtggtg
gtggacgagaagcccttcctgcagtgcacccgtagcatcgagacgggcaagaccaactac
aacacttgctatacggcgggcgtctgcctcctcaaggcccggcagaagattgccgtgaag
atggtgcacgccgacatctctatcaatatgagcaagcacaccaccttctttggggccatc
aggctgggcgaagcccctgcctcgtag

DBGET integrated database retrieval system