KEGG   Oryctolagus cuniculus (rabbit): 100340118
Entry
100340118         CDS       T03373                                 
Symbol
ARHGEF12
Name
(RefSeq) Rho guanine nucleotide exchange factor 12
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04270  Vascular smooth muscle contraction
ocu04360  Axon guidance
ocu04611  Platelet activation
ocu04625  C-type lectin receptor signaling pathway
ocu04810  Regulation of actin cytoskeleton
ocu05135  Yersinia infection
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100340118 (ARHGEF12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100340118 (ARHGEF12)
   04625 C-type lectin receptor signaling pathway
    100340118 (ARHGEF12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100340118 (ARHGEF12)
  09158 Development and regeneration
   04360 Axon guidance
    100340118 (ARHGEF12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340118 (ARHGEF12)
   05205 Proteoglycans in cancer
    100340118 (ARHGEF12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100340118 (ARHGEF12)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100340118 (ARHGEF12)
   05152 Tuberculosis
    100340118 (ARHGEF12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100340118 (ARHGEF12)
Membrane trafficking [BR:ocu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100340118 (ARHGEF12)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 PDZ_2 Peptidase_M50 Ribonuc_2-5A Tricorn_PDZ
Other DBs
NCBI-GeneID: 100340118
NCBI-ProteinID: XP_008258809
Ensembl: ENSOCUG00000005196
UniProt: A0A5F9D7E5
LinkDB
Position
1:complement(97490757..97653321)
AA seq 1544 aa
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSTSHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSVIGHMSPVMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPVQRLLKEIQ
EAKRHIPQLQEQLSKATGPAQDGAIVTPSRPLGDALTVSDAEVDPGDGLSRTDCSSGDTS
RPSSDNTDSPRSGLKERISLEENTEKNEAIQDSDTQSLIGSPSTRITPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
IFLEFHQFFLDRSANLKVSVPDEISVDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRIILEKERACAEQIVAKIEEVLMTAQAVEEEK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKVRHPKHLSTPLSVSPEPQDSTKLRQSGLANEGSDIGY
APAGSVSSVASGAALSQEGGKENEMGSKPVGETPASGDSLDGTPRTPNTASDFPPPPLDQ
VQEEECEVERVIEHGTPKPVRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLNTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLSESPPCEGDNDEEEPPKLKVEHHSISVTGLQSPDRDLGLESSLISSKPQSHSLITS
GKSEVDDLFVTERQFAKERNTDGTLKDVGVNYQITIPDSHLSVSEERWALDALRNLGLLK
QLLAQQLGLTEKSTQEDWQHFPRQRTASRGAQADSGTQNSENIQAYHPGEGQIPVRTGTG
DIATCYSPRTSTESSAPRDSVVLASQDSQASSILVMDHMIMTPEMPTTEPEGGLDESGEH
FFDAREAHSDDNPSEGDGAVKKEEKDVNLRISGTCLILDGYELMQESSTDEEVASSLALQ
PATGIPSADSPYPQQHSPQNAYSEEAVSPFSPEFLVQQRWGAMEDSCFEIQSPLSCADSH
SLIMEYIHKIEADLEHLKKVEESYTILCQRLAGSALADKHSDKS
NT seq 4635 nt   +upstreamnt  +downstreamnt
atgagtggcacacagtctactatcaccgacaggtttcccctcaaaaaacctataaggcat
ggaagtattttgaaccgagagtcaccaacagataagaagcagaaagttgaacgcagtaca
tcgcatgattttgatcccacagacagctcctccaagaagacaaagtctagttcagaggag
agtagatccgagatatatggtcttgttcagcgttgtgtgatcatccagaaagatgacaat
ggatttgggttgacggtcagtggagacaatcccgtcttcgtacagtctgtaaaagaagat
ggagcagccatgcgggctggtgtacagacaggtgatcgaatcatcaaggtgaatggaact
ctggtgactcattcgaaccatttggaagtggtgaagctaatcaaatctggttcctatgta
gctctcactgttcagggacgcccacctgggtcgccccagattccgctcgccgattctgaa
gtagaaccatcagtcattggacatatgtctcctgtcatgacatcccctcattcacctgga
gcatctgggaatatggagagaatcactagtcctgtgcttatgggggaggaaaacaatgtg
gttcataaccagaaagtagaaattctgagaaaaatgttacagaaagaacaggaacggcta
cagttattgcaggaagattacaaccgaacacctgtccaaagattgctaaaagagatccaa
gaggccaagagacacattcctcagctgcaagagcagttatccaaagccacaggccctgct
caggatggagccatagttacaccctccaggcctctaggtgatgccctgacagtcagtgat
gcagaggtggatcctggagatggactgagcaggactgattgcagcagtggagatacttct
cggccgagtagtgacaacacagatagtcccaggagtggcctgaaagagaggatttctcta
gaggaaaacacagagaaaaatgaagcaattcaggacagtgacactcagtcacttatcggg
agtccctcaacccgcataacacctcatattattggagcagaagatgatgattttggaact
gaacatgaacagattaatgggcagtgcagctgtttccagagcattgaactgctgaaatct
cgccctgctcatttggctgtttttttacaccatgtagtttcacagtttgaccctgcaaca
ttgctctgttatctctattcagacttgtataaacagaccaattccaaggaaactcgtcgc
atcttcctggagtttcatcagttcttcctggatcgatctgcaaatctgaaagtttcggtt
cctgatgaaatatctgtggatctagaaaagagacgaccagagcttatacctgaggatctg
catcgccactatatccagactatgcaagaaagagtccaccccgaagttcaaaggcacttg
gaagattttcggcagaagcgtagcatgggactgacgttggctgaaagtgaactgactaag
cttgatgcagagcgagacaaggaccgcatcattttggagaaggagcgggcatgtgcagaa
caaattgttgccaaaattgaagaagtgttgatgactgctcaggctgtagaagaagaaaag
agttccacaatgcagtatgttattctcatgtacatgaagcatttgggagtaaaagtgaaa
gaacctcgaaatttagagcacaagcggggtcggattggattccttccaaaaatcaaacaa
agtatgaagaaagatagagaaggcgaagaaaaaggaaagcgaagaggattccccagtatc
ctgggacctccaaggagaccgagtcgccatgacaacagtgcaattggcagagccatggaa
ctgcagaaggtgcgccaccctaagcatttatccacacccttatctgtgagtcctgaacct
caggactctactaagttgcgccagagtgggttagcaaatgaaggatcagacattggatat
gcacctgccggttctgtgtcctctgtggcttcaggggctgctctttcccaggaaggagga
aaagagaatgagatgggatcaaagccagttggagaaacaccagcatctggagactccttg
gatggtacacctcgtactcccaatactgcctctgattttcctcctcctccattagaccaa
gtgcaagaggaggaatgtgaagtagaaagggtgattgaacatggaacaccaaaacctgtt
cgaaagtttgacagcatagcttttggagaaagtcaaagtgaggatgaacaatttgaaaat
gacttagagacagatccacccaactggcagcagcttgttagtcgagaagtgttactgggc
ctgaaaccttgtgagatcaaaagacaagaagtaattaatgaattgttctacacagaacga
gctcatgttcgaacactgaaagttcttgatcaagtgttttatcagcgagtgtccagagaa
ggaattttgtcaccttcagaactacggaagattttttcaaacttagaagatattcttcaa
cttcatattgggttgaatgaacaaatgaaggctgttcgaaagaggaatgagacctctgtt
attgatcaaattggggaagatttgctgacctggttcagtggaccgggagaagagaagctg
aaacatgccgctgccaccttttgcagtaaccagccttttgccctagaaatgatcaagtct
cgtcagaaaaaggactctcgattccagacttttgtacaagatgctgagagtaatcctctg
tgtcgtcgtctccagctaaaggatatcattcccactcaaatgcagaggcttaccaagtat
ccacttctgttggataatattgccaaatataccgaatggccaacagaaagggagaaggtg
aagaaagctgcagatcactgtcgtcagatcttaaattatgtaaatcaagctgtcaaggag
gcagaaaacaagcagcgcttagaagattatcagcgccgtcttgatacctccaatctgaag
ttgtcagagtacccaaatgtggaagagctcaggaatttggacttaacaaaaaggaagatg
attcatgaagggccattggtttggaaggtgaatagagataaaactattgatctgtataca
ttgctgctggaagacattcttgtattgttacaaaaacaggatgatagactggtgttaagg
tgtcacagtaagattctagcttccacagctgatagcaaacacacgtttagccctgtcatt
aagttgaatacagtgctggttcgacaggtggcaacagataacaaagctttatttgtcatc
tccatgtccgacaatggagcccaaatttatgaactggtggcacagacagtttctgaaaag
actgtctggcaggacctcatctgtcggatggctgcatcagtgaaggagcagtccacaaag
ccaatcccattatcagagtctccaccttgcgaaggagacaatgatgaagaagaacctcca
aaattaaaagtggaacatcatagcatttcagtcactggtctgcagagtccagacagagat
ttgggattagaatcttccttaatatcatcaaaacctcagtctcattcactgattacttct
gggaaatcagaggtagatgatctctttgtgactgagagacaatttgcaaaggaacggaat
acagatggaacactaaaggacgttggagtaaattatcaaatcacaatcccagattcacac
ttgtctgtctcagaagaacggtgggctttggatgcactaaggaatttgggtttgttgaag
cagttgctggcacaacagctgggtttgactgagaagagcactcaggaagactggcaacat
ttcccaagacagaggacagcctctcggggggctcaggcagacagtggaacccagaactct
gaaaatattcaggcgtatcaccctggtgaaggacagatacccgttagaactggaactggt
gacattgcaacttgttacagtccacggacttcaactgaatcttctgctccacgggattca
gtggtactggcatcccaagatagccaggcaagtagcattttagtaatggaccacatgatt
atgaccccagagatgcctaccacagagccagaagggggtcttgatgagagtggagagcac
ttttttgatgcccgtgaagcacatagtgatgataatccatcagaaggtgatggagcagtt
aaaaaggaagagaaggatgttaatttacgcatctcaggaacctgtctgatccttgatggc
tatgaactcatgcaggagagctctacagacgaggaggtcgcctcctcactcgccctgcag
cctgccacaggcatcccctctgcagactctccctacccgcagcagcattcgccccaaaat
gcttattctgaggaggccgtttcacccttcagcccagaattcctggtccagcagcgctgg
ggagctatggaggattcctgttttgagatccagagtcctctgtcttgtgcagattcacac
agcctgatcatggagtacattcataagatagaggctgaccttgaacacttaaagaaggtg
gaagaaagttacaccattctttgccaaaggctggctggatcagccctcgcagataagcac
tcagataagagttag

DBGET integrated database retrieval system