KEGG   Oryctolagus cuniculus (rabbit): 100340179
Entry
100340179         CDS       T03373                                 
Symbol
PSD
Name
(RefSeq) pleckstrin and Sec7 domain containing
  KO
K12494  PH and SEC7 domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100340179 (PSD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100340179 (PSD)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100340179 (PSD)
SSDB
Motif
Pfam: Sec7 PH_9 PH
Other DBs
NCBI-GeneID: 100340179
NCBI-ProteinID: XP_008268632
LinkDB
Position
18:complement(50412858..50426115)
AA seq 1025 aa
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRGREL
GRMTAPCTPLRGPPSPRVAPSPWAPSSPTGQPPPGARSSVVIFRFVEKASVRPLNGLPAP
GGLSRSWDLGGVSPPRPTLALGPGSNRKLRLEASTSDPLPAGRSSALPGSRDAVQGPPVT
SQVGADGLYSSLPNGLGGAPEHLATLFRGPADTGFLNQGDTWPSPWEASSRAQRIARAKW
EFFYGSLDPPSSGAKPPEQAPPSAAGAGSGQSSGVSVGRAAKCSETDLDKVPLRCYRETD
IDEVLAEREEADSAIESQPSSERLPGTARPPAPRPGPCLGPGSSLGSGDEDEDEAGGEED
VDDEVFEASEGARPGSQMPHSGPLKSPVPFLPGTSPSADGPDSFSCVFEAILESHRAKGT
SCTSLASLEALASPGPTQSPFFTFELPPQPPAPRPDPPARAPLAPLEPDSGTSSAADGPW
TQRGEEEAEPGTKLVPGREPPSPCHSEDSLGPGAAPLGSETPLNPLVSDSDSELDSTERL
ALGSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFV
FTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALML
LNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRR
SLSELADPNPKVIKRVSGGSGSSSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRG
KRGWKSFHGILKGMILYLQKEEYQPGKALSEVELKNAISIHHALATRASDYSKRPHVFYL
RTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLS
QEEQVRTHEAKLKAMASELREHRAALQGKKARGKEAEEQRQKEAYLEFEKSRYGTYAALL
RIKLKAACEELDAVEAALAQAGCAEDGLPPSHSSPSLQPNPSSQPRAQRHGSEPRAGAGS
GRWKP
NT seq 3078 nt   +upstreamnt  +downstreamnt
atggcccagggtgccatgcgcttctgctcggaaggcgactgcgccatctccccaccacga
tgccctcgccgctggctcccggaaggcccagtgccccagagcccccccgccagcatgtat
ggcagcacaggctctctgcttcggcgagtagcaggtccaggtccccgaggccgggaactg
ggacgtatgacagcaccctgtacacctctgcgtgggcccccctcaccccgtgtggctccc
tcgccctgggcaccctcttcacccactgggcagcctccaccaggggcccggagctctgtg
gtcatcttccgctttgtggagaaggccagtgtgaggccactgaatgggctaccagctcct
ggaggcttgagtcggagctgggacctgggtggagtttctcctcccagacccaccctagcc
cttgggcctggctccaaccggaagttgcggctggaggcatccacatcagatcccctccca
gctggacgaagctcggcccttcctggcagccgggacgctgtccaggggccgccagttaca
tcccaggttggggcagatggcctctactcctctctccccaatggcctggggggggcccct
gagcacctggccacgctcttccgaggacctgctgacactggattcctgaaccagggagac
acctggccctccccttgggaagcctcctctcgtgcccagagaatcgctcgagccaaatgg
gaattcttctatggctccttggacccccccagctcaggtgctaagcccccagagcaggcc
cccccatccgcagctggggcgggctcagggcagagctctggggtgtctgtggggcgagca
gccaagtgctccgagacggacctggacaaggtgcccctgaggtgctaccgtgagactgac
atcgatgaggtgctggccgagcgggaggaggctgattcagccatcgagagtcagccgagc
tctgagcgcctgcctggcactgcccgcccacctgccccacgtcctggtccctgcctgggc
cctggttccagcttgggcagtggcgatgaggatgaggatgaggcaggcggggaggaggat
gtggacgacgaggtgtttgaggcctcagagggggcccggccagggagccagatgcctcac
tctgggcctctcaagtcacctgtgccctttcttcctgggaccagtccctcagcggatggg
cctgactctttcagttgtgtgtttgaagccatcctggagtcacatcgggccaagggcacc
tcctgcaccagccttgcctcgctggaggccttggcctcacctggcccaacccagagcccc
ttcttcacctttgagctgcctccccaaccccctgccccccggcccgacccacctgctcgt
gccccacttgcccctcttgaaccggattctggtaccagctccgctgccgatggtccttgg
acacagagaggggaggaggaggcagagccgggaaccaagctggtcccggggagggagccc
cctagtccctgccactcggaggacagccttgggccgggggcagcaccccttggcagcgaa
acgcctctgaacccactggtgtctgactcggactcagagctggacagcacagagcggctg
gctctggggagcacagacaccttgtccaacgggcagaaagcggatctggaggccgcgcag
cgcctagccaagaggctgtaccgactagacggcttcaggaaggccgacgtggcccggcac
cttggcaagaacaatgacttcagcaaactggtggctggcgagtacctcaagttctttgtc
ttcacgggcatgacgctggatcaggctctcagggtgtttctgaaagagctggccttaatg
ggtgagacccaggaacgggagcgtgtgctggcccacttctcccagcgatacttccagtgc
aatccggaagccctgtcttcagaggacggcgcccacacgctgacctgcgccctcatgcta
ctcaacaccgatctccatggtcacaacatcgggaaacgcatgacctgcggagacttcatc
gggaacctggagggcctcaacgacggaggcgacttccccagggagctgctcaaggcctta
tacagctccatcaagaatgaaaagttgcagtgggccatagacgaggaggagctgagacgc
tctctgtctgagttggccgaccccaaccccaaggtcatcaagcgggtcagcgggggcagc
ggcagcagctccagccctttcctggacttgactcccgagccgggcgctgctgtctacaag
cacggggccctggtgcgaaaggtgcacgcagaccctgactgcaggaagacacctcggggc
aagcggggctggaagagcttccacggaatcctcaagggcatgatcctctacctgcagaag
gaggagtaccagcctggcaaggccctttcagaggtggagctcaagaatgccatcagcatc
caccacgccctggccacccgcgccagtgactacagcaagaggccccacgtcttctacctg
cgcacagcggactggcgagtcttcctctttcaggccccgagcctggagcagatgcagtcc
tggatcactcgcatcaatgtggtggccgccatgttctctgcacctcccttcccagctgct
gttagctcccagaaaaagttcagccgccccctgctgcccagcgctgccacccgcctctcc
caggaggagcaggtgcggacccacgaggccaagctgaaggccatggcaagtgagttgcgg
gagcaccgggctgccctgcagggcaagaaagcccgcggcaaggaggctgaagagcagcgg
cagaaggaggcctacctggagtttgagaaatcccgttacggcacctacgctgcgctgctt
cggatcaagctgaaggcagcgtgcgaagagctggatgcggtcgaggcagcgctggcccag
gctgggtgcgccgaggacggactccctccttctcactccagtccctccctgcagcccaac
ccttccagccagccccgggctcagcgtcacggctctgagcctcgggcaggggcaggcagt
gggcggtggaagccctga

KEGG   Oryctolagus cuniculus (rabbit): 100340681
Entry
100340681         CDS       T03373                                 
Symbol
PSD3
Name
(RefSeq) pleckstrin and Sec7 domain containing 3
  KO
K12494  PH and SEC7 domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100340681 (PSD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100340681 (PSD3)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100340681 (PSD3)
SSDB
Motif
Pfam: Sec7 PH_9 PH
Other DBs
NCBI-GeneID: 100340681
NCBI-ProteinID: XP_008265480
Ensembl: ENSOCUG00000022679
LinkDB
Position
15:complement(3216709..3800040)
AA seq 1165 aa
MAEQPPPQQMETSFLFIQLRAPPAPAVPAQSPAAAAAPGGLEEGHIPPSPRTGLAGWDLR
RTQGLAASPWSLLHKAGPGPEQPAALRCCSAREKEAGDKLQGLDVTRGGVCASPRGRHCR
APTSRKLGGLQALSCRPRWPAPIMNHGNSDRSTGGRHWPAFSAPQELWGVDHHSRDAWAC
SVLQATTAHAARMDKRSPLMESAETCGRLPKSYGSGSGPAGQATRARLYRYRPAVQTSQC
CPAPPAALPLKAETFVWVNNASAHSQSVAKAKYAFLFGRSEEKTPDTGDHGGSTLLPSNV
TNEFPEYGTMEEGGEGLKASLELDAESLPCRAAGQQGVQRPAGPYAGPDSVTGPKGVREA
PSQSHLKEQSLQPIDSLISALKATEARIVSETLQATKVLDKDAVSSFSVQQVEKELDSGS
RKTQRASEPLTAGQENTRDIPLPAEEKGEENLYLSIQKDLAALLTGETQAELPQITSNGS
KGAVCVQEPACPVSCMGGHTATCSPVHGVGFLKEQRSDLGREHPGRCDHSSSTGRPGRTK
HVEFHGVEILWTGERRETQHPTDMETSLERRASLESKAFSKAPSHLPPSAGLPDSRRGES
WRAPGERPGTSSGTFSPVPLLESGEDEVFLKENRHPLEKDKERTLDQEEHTRGGDDDILG
PGYTEDSTDVYSSQFETILDNTSLYYSAESLETLYSEPDSYFSFEMPLTPMIQQRIKEGG
QFLERTSAGGQQDVLSVSADGGIVMGLSSGITNGLSDGNNCIYLEGTPEMAFWQSNPGVK
TTCLEAHSEMGSTEILEKETSESLSNGTSSNVEAAKRLAKRLYQLDRFKRSDVAKHLGKN
NEFSQLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERERVLVHFSNRYFYCNPDT
IASQDGVHCLTCAMMLLNTDLHGHNIGRKMTCQEFIANLQGVNEGADFPKDLLKALYNSI
KNEKLEWAVDDEEKKKSPSEGTDEKANGMHPKTISRIGSTTNPFLDIPHDPNAAVYKSGF
LARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEKALSEEDLKNAVSLHHA
LASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVFSAPPFPAAIGS
QKKFSRPLLPATTTKLSQERTAEIP
NT seq 3498 nt   +upstreamnt  +downstreamnt
atggccgagcagcctccgccacagcagatggaaacttccttcctcttcatccagctgcgg
gccccccctgcaccagctgtccccgcccagtctccagccgctgccgcagccccaggaggc
ctggaggagggacacattcccccaagtcccaggacaggcttggcaggctgggacctcagg
cgcacacagggcttggctgcatctccgtggagcctgctgcataaggcagggcccggccca
gagcaaccagccgctctccgctgctgctcagcgagggagaaggaggcaggggacaagctc
cagggtctggatgtgacaagaggcggcgtgtgtgcatccccgcgtggcaggcactgcagg
gcccctacctctaggaaactaggcgggctccaggccctgtcatgcaggcctcgttggcca
gctcccatcatgaaccatggaaacagcgatcgctccacgggcgggagacactggccggcc
ttttctgccccccaggaactgtggggcgtggaccaccactccagagatgcctgggcgtgc
tcagttctgcaagctaccacggcccacgctgcccgcatggacaagaggtctcccctgatg
gagagtgctgagacctgcgggcgactcccaaagagttatggctcaggctcgggtcccgca
ggacaggcgacaagggcacgactctacagataccgccccgccgtgcagaccagccagtgc
tgcccggccccacctgccgctctgcctctcaaggcagagacatttgtttgggttaacaat
gcatcagcacattcccagagtgttgccaaggccaaatatgcatttttatttggcagatct
gaagagaaaactccagacactggtgatcatggaggaagcactttactcccatcaaatgtc
acaaatgaatttccagaatatgggaccatggaggagggtggcgagggcctaaaagcctcc
ctggagcttgatgcagagtctctgccatgccgcgcagcaggccagcaaggtgtccagcgg
cctgctggcccctatgccgggcccgacagtgttacaggaccaaaaggtgtcagagaggcc
ccttctcaaagtcacctcaaggaacaaagtttacagcccattgactctttgatttcagct
ctgaaagccacagaagccagaatagtttcagaaacattacaggctacaaaggtactggac
aaagatgctgtttctagtttttcagttcagcaggtggagaaagagctggacagtggcagc
cgtaaaacacagagagccagtgagccccttactgctggccaggaaaacacacgagatata
cctcttccagctgaagaaaaaggcgaggaaaatttgtatttgagcatccagaaggacctg
gctgcactgttaactggagaaactcaggctgagcttccccagataaccagtaatgggagc
aaaggggctgtctgtgtgcaggagccagcctgtcctgtgtcctgcatggggggccacaca
gcgacctgcagtcctgtccatggtgttgggttcttgaaagagcaaaggtctgatcttggg
agggagcacccagggagatgtgatcatagcagctctacaggccgcccgggccggaccaag
catgtggaatttcatggtgtagagatactgtggacgggagagaggagagagacccagcac
cctacagatatggagacatcactggaaagaagagcctcacttgagagcaaagcattttcc
aaggcgcccagccatctccccccgtccgctggtctgcctgattcacggcggggtgaatcc
tggagagctcctggagagaggcctggcaccagctcagggacattttcccctgtgcctctc
ttggagagtggagaggatgaagtcttcctgaaggaaaacagacaccctctggagaaagac
aaggaaaggacccttgaccaggaggagcataccaggggaggagacgatgatattcttggg
cccgggtatacagaggactccactgatgtgtacagctcccagtttgaaaccattttggac
aacacttctttatactacagtgcagagtccttggaaacgttatactcagagcccgacagc
tatttcagctttgaaatgcccctcacgcccatgatacagcagcgcatcaaggaaggtggc
cagtttttggaaaggacatcagcgggaggacagcaggatgtcctgagtgtctctgcggat
ggcggcatagtgatggggctttctagtggaatcaccaatgggctgagtgatggcaacaac
tgcatctacctggaaggcacccccgagatggctttctggcaaagcaatcctggggtgaaa
acaacatgtctagaggctcattctgaaatggggagcactgaaatcctggaaaaggagacc
tcagaaagtctcagcaatggtaccagcagcaacgtggaagcagccaaaaggttggccaaa
cgcctctatcaactggacagattcaagaggtcggatgttgcgaaacacctcggcaagaat
aatgaatttagccaactcgttgctgaagaatatctgaagttttttgattttacaggaatg
acgctggaccagtctctcaggtatttttttaaggctttttctcttgtgggagaaactcaa
gaacgagagagagttttagtacacttctccaatagatatttttattgtaatccagacacc
attgcttcacaagatggagtccattgccttacctgtgctatgatgcttctcaatacggat
ctgcatggccacaatattggaaggaagatgacctgccaagagttcattgcaaatctccaa
ggggtaaatgaaggtgctgatttccccaaggatctgttgaaagctctgtacaattcgatc
aagaatgagaagcttgaatgggcagtagatgatgaagagaaaaaaaagtctccctcagaa
ggcactgatgagaaggctaatggaatgcatccgaaaaccattagtcgcataggcagcacc
acaaacccatttttggacattcctcatgacccaaatgctgctgtgtacaaaagtggattc
ttggctcggaaaatccatgcagatatggatggaaagaagactccaagaggaaagcgagga
tggaaaaccttttatgctgtactgaagggaacagttctttacttgcaaaaggatgagtat
aagccagagaaggccttgtctgaggaggacctgaagaacgctgtgagcctgcaccacgcc
ctggcctccaaggccacggactacgagaagaagcccaacgtgttcaagctcaaaactgcc
gactggagggtcttgctttttcaaacccagagtccagaggaaatgcaagggtggataaac
aaaattaactgtgttgcagctgtattttctgcaccgccttttccagcagccattggctct
cagaagaagttcagccgcccacttctgcctgccacaacaacaaaattgtctcaagagaga
acagctgaaatcccatga

KEGG   Oryctolagus cuniculus (rabbit): 100341977
Entry
100341977         CDS       T03373                                 
Symbol
IQSEC2
Name
(RefSeq) IQ motif and Sec7 domain 2
  KO
K12495  IQ motif and SEC7 domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100341977 (IQSEC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100341977 (IQSEC2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100341977 (IQSEC2)
SSDB
Motif
Pfam: IQ_SEC7_PH Sec7 PH_19
Other DBs
NCBI-GeneID: 100341977
NCBI-ProteinID: XP_017205306
Ensembl: ENSOCUG00000027852
LinkDB
Position
X:complement(34736391..34825379)
AA seq 1522 aa
MEAGSGPPGGPGSESPNRAVEYLLELNNIIESQQQLLETQRRRIEELEGQLDQLTQENRD
LREESQLHRGELHRDPHGARDSPGRESQYQNLRETQFHHRELRESQFHQAARDVGYPNRD
GAYQNREAVYRDKERDASYPLQDTTGYTARERDVAQCHLHHENPALGRERGGREAGPAHP
GREKEAGYSAAVGVGQRPPRERGQLSRGASRSSSPGAGGGHSTSTSTSPATTLQRKSDGE
NSRTVRSTASHTLHQYCCPTQVLDSMKLTPSGRLAESSVEGDAPGSDLSTAVDSPGSQPP
YRLSQLPPTSSHMGGPPAGVGLPWAQRARLQPASVALRKQEEEEIKRSKALSDSYELSTD
LQDKKVEMLERKYGGSFLSRRAARTIQTAFRQYRMNKNFERLRSSASESRMSRRIILSNM
RMQFSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLDRGLPYGGSCGGGIDGGGSSVT
TSGEFSNDITELEDSFSKQVKSLAESIDEALNCHPSGPMSEEPGSAQLEKRESKEQQEDS
SATSFSDLPLYLDDPVPPQSPERLPSAEPPPQGRPEFWAPAPLPPVPPPVPPGTREDGSR
EEGTRRGPGCLECRDFRLRAAHLPLLTIEPPSDSSVDLSDRSDRGSVHRQLVYEADGCSP
HGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPGPLPPAPNSGTGPSGVAGGRRLGKCEAAG
ENSDGGDNESLESSSNSNETINCSSGSSSRDSLREPPATGLCKQTYQRETRHSWDSPAFN
NDVVQRRHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLG
NRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYCVCN
PALVRQFRNPDTIFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIPRDL
LVGIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPVLSLPHRRLVCCCQLYEVPDPNRPQ
RLGLHQREVFLFNDLLVVTKIFQKKKILVTYSFRQSFPLVEMHMQLFQNSYYQFGIKLLS
AVPGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKYRVESELEKQKGMMRPNASQ
PGGAKDSVNGTLARSSLEDTYGAGDGLKRGALSSSLRDLSDAGKRGRRNSVGSLDSTIEG
SVISSPRPHQRMTPTPSPPPTENARSLRPSPNSSSFLGSLFGSKRGQGAFQMPPPPPTGQ
ASASSSSASSTHHHHHHHHHGHSHGGLGGGCLTGSPSSRALHAQYCQGPGPAPPPYLPPQ
QPPLPPPPQQPPPLPQLSSIPPPPASAPPVGPHRHFHAHGPVPGPQHYTLGRPGRAPRRG
AGGHPQFAPHGRHPLHQPTSPLPLYSPAPQHPPAHKQGPKHFIFSHHPQMMPAAGAAGGP
GSRPPGGSYSHPHHPQSPLSPHSPIPPHPSYPPLPPPSPHTPHSPLPPTSPHGPLHASGP
PGTANPPSANPKAKPSRISTVV
NT seq 4569 nt   +upstreamnt  +downstreamnt
atggaggcggggtcggggcccccgggcggcccgggatctgagagccccaaccgggcggtg
gagtacctgctggagctgaacaacatcatcgagagccagcagcagctgctggagacccag
cggcggcgcatcgaagagctggagggccagctggaccagctcacccaggagaaccgcgac
ctgcgggaggagagccagctgcaccgcggggagctgcaccgggacccccacggcgcgcgg
gatagcccgggccgcgagagccagtaccagaatctgcgtgagacccagtttcaccaccgc
gagctgcgggagagccagttccatcaggcggcccgggacgtgggctacccgaaccgggac
ggcgcctaccagaaccgggaggctgtgtatcgggacaaggagagggacgcctcctacccg
ctccaggacactaccggctacacagcccgcgagcgcgacgtggcccagtgccacctgcac
cacgagaacccagccctgggtcgcgagcgtggcgggcgggaggctgggccagcgcacccg
ggccgcgagaaggaagccggctactcggcggcggtgggcgtggggcagcggccgccgcgg
gagcggggccagctgagccgtggcgcatccaggagctccagccccggcgccggcggaggc
cacagcaccagtaccagcaccagcccggctacaaccctccagagaaaatctgatggtgag
aattccagaacagtcaggtccacagcgtctcacactctacaccagtattgctgtcctact
caggtccttgactccatgaagcttaccccctcaggcaggctggcagagagcagtgtggag
ggtgatgccccaggcagtgacctgagcacagcggttgatagtcctgggagccagcccccc
taccggctgagccagctgcctcccaccagcagccacatggggggcccccctgctggggtg
ggccttccctgggctcagcgggctcgcctccagccggccagtgtcgccctgaggaagcag
gaggaggaggagataaagcgctccaaggccttatcggacagctatgaactctccacggac
ctgcaggataagaaggtggaaatgctggagaggaagtatgggggctccttcctgagccgc
agggctgccaggaccatccagacagccttccgccagtaccgcatgaacaagaactttgag
cggctccgcagctcagcttcggaaagtcgcatgtcccgccgtatcatcctttccaacatg
cggatgcagttctccttcgaggagtacgagaaggcacagaaccccgcgtacttcgagggc
aagcctgcctcgctggacgagggtgccatggctggtgcccggagtcatcggcttgatcgg
gggctcccgtatggaggctcctgtggtgggggcattgatggcggtggaagctctgtcacc
acgtctggagagttctccaatgacatcacagagcttgaagactccttctcgaaacaggtc
aagtctctggctgaatccatcgatgaggccctaaactgccacccttcagggcccatgtct
gaggagccggggtcagcccagctggagaagcgggagtcaaaagaacagcaggaggacagc
tcagccacatccttcagtgaccttcccctctacctggatgacccagtgcccccacagtcc
cctgaacgactgcccagtgcagagcccccaccccagggccgacccgagttctgggcacca
gctcctctcccaccagttccaccaccagtgccaccagggacccgggaagatgggagccgt
gaggaaggcactcgcaggggtcccgggtgcctggaatgccgggatttccggctgcgggct
gcccaccttcccctgctcaccattgagcctcctagtgacagctccgtggacctgagtgac
cgctcggatcgcggctctgtccaccgccagctggtgtacgaggctgatggctgcagcccc
catgggaccctcaagcacaaggggccaccaggcagggcccccatcccacaccgccactac
ccagcccctgagggcccagctccagccccaccaggtcccctgcccccagcccccaacagt
ggcaccgggcccagtggtgtggctgggggtcggaggctggggaaatgcgaggcagcaggc
gagaactctgatggaggagacaatgagagcctggagagctccagcaattccaatgagacc
atcaactgcagctccggctcctcttctcgggacagcctgagggagcccccagccactggc
ctgtgcaagcagacataccagcgggagaccaggcacagctgggactccccagccttcaac
aacgacgtggtgcaaaggcggcactacagaatcggcctcaacctcttcaataagaagcca
gagaagggtatccagtatctcatcgagcggggcttcctgtcagatacaccggttggagtg
gcccatttcatcctggagcggaaaggcctgagccggcagatgataggggaattcctaggg
aaccggcagaagcagttcaacagagatgtgttggactgtgtggtagatgagatggacttc
tcctccatggatctggatgatgcactccgcaagttccaatcccatatccgggttcagggc
gaagcccagaaagtggagcgcctcatcgaagccttcagccagcggtactgtgtctgtaac
ccagccctcgtccgccagttccggaacccagacaccatcttcatccttgcttttgccatc
atccttctcaatactgacatgtacagtcccagtgtcaaggctgaacgcaagatgaaatta
gatgacttcatcaagaacctaagaggggttgacaatggtgaagacatcccacgagacctc
ctggtgggcatttatcagcgcatccagggccgtgaacttcggaccaatgatgaccatgtg
tcccaggtgcaggctgtggagcgcatgattgttggcaagaaaccggtcctgtctcttcct
caccgtcgcctggtttgctgctgccagctctacgaggtgccagatcctaaccgcccccag
aggctagggttgcatcagcgggaggtcttcctcttcaatgatctcctcgtggtcaccaaa
attttccagaagaagaagatcttggtgacgtacagcttccgtcagtcctttcccctggtg
gaaatgcacatgcagctctttcagaattcatattaccagtttgggatcaagttgctgtct
gcagtgccaggtggtgagcgcaaagtcctcatcatcttcaatgcccccagcctccaggac
cggctgcgcttcacatcggacctgcgcgagtccatcgcggaggtgcaagagatggagaaa
taccgcgtggagtccgagctggagaaacagaaaggtatgatgcggcctaacgcctcacag
cctggaggggccaaggactcagtgaatgggacgctggcccgcagtagcctggaggacact
tatggggcaggcgatgggctcaaacggggcgcactcagcagttccctgcgagacctctct
gatgcagggaagcgggggcggcgtaacagcgtgggatcgctggacagcaccatcgaaggg
tctgttattagcagtccacgccctcaccagaggatgacacctacgccctcccccccgccg
acagagaatgcaaggagcttacgaccgtctcccaactcctcatccttcctgggctcccta
tttggaagcaagcgggggcaaggggccttccagatgccaccaccaccgccaacaggccag
gcctctgcctcctcttcatctgcttcttccactcaccaccaccaccaccatcaccaccat
ggtcacagccacggtggcctgggggggggctgcctgacgggcagtccaagctccagggcc
ctgcatgcccagtattgccaaggaccaggccctgccccaccgccctacctcccaccgcag
caaccccctctacccccacctcctcagcagcccccacccctgccccagctgagttccatt
ccgccacctcccgcctcagccccacccgtggggccgcatcgccacttccatgcccacggc
ccagtcccagggcctcagcactataccttgggccggccaggcagggctcccagacggggg
gctggaggacaccctcagtttgctccacatggccgccaccccctgcaccagcccacgtcc
cctctgcccttgtacagtcctgccccccagcaccctcctgcccacaaacagggccccaag
cacttcatcttcagtcaccacccacagatgatgccagcagcaggagcagctgggggccct
ggatcccggccgccagggggctcctactcacacccccaccacccccagtcgcctttgtca
ccgcactcacccatcccaccccacccctcctacccacccctgcccccgccctcaccccac
accccgcactcacccctgccacccacctctccccacggcccgctgcacgcctctgggccc
cctggcactgccaacccacccagtgcaaaccccaaggccaagccaagccggatcagcacc
gtggtctga

KEGG   Oryctolagus cuniculus (rabbit): 100344254
Entry
100344254         CDS       T03373                                 
Symbol
GBF1
Name
(RefSeq) golgi brefeldin A resistant guanine nucleotide exchange factor 1
  KO
K18443  golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100344254 (GBF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100344254 (GBF1)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    100344254 (GBF1)
SSDB
Motif
Pfam: Sec7 Sec7_N DCB DUF758 DUF1045
Other DBs
NCBI-GeneID: 100344254
NCBI-ProteinID: XP_008268624
Ensembl: ENSOCUG00000005714
LinkDB
Position
18:50243378..50396282
AA seq 1896 aa
MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFSHLKEVLNSITELSEIE
PNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGMENMADAVTHAR
FVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKS
AEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKISPCLLNKLELNSGEQTKALNQLERVL
LFKNLKLKMRAGGMSDSSKWKKQKRSPRPPRHMTKVMPSSELPTPNGTTLSSNLTGGMPF
IDVPTPVSSVSSEAASAVVSPSTDSGLEFSSQTTSKEDLTDLEQPGSPGYSTAAEPGSSE
LGVLEQPDLQTQQERAHVEKAQSASVESIPEVLEECASTADHSDSASVHDMDYVNPRGVR
FTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLHLLTVALESAPVA
QCQSLLGLIKDEMCRHLFQLLSVERLNLYAASLRVCFLLFESMREHLKFQLEMYIKKLME
IITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAF
PVSGQLYTTHLLSLDALLTVIDSTEAHCQAKVLNSLTQQEKKEPARASHEAVDVIREASN
TERATSDGKAIGLAPDVPGLHLPSGGRLSTELGKPGCGDLQEAGDSGADKKFTRKPPRFS
SLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQFLQEKGLLTIPMDNTEVAQWLRENP
RLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDEALRLYLEAFRLPGEAPVIQRLLEA
FTEHWRNCNGSPFANSDACFALAYAVIMLNTDQHNHNVRKQNAPMTLEEFRKNLKGVNGG
KDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVWNVLLHRGATPEGIFLRVPPGSYDL
DLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKF
TALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHGDILREGWKNIMEAMLQLFRAQLLP
KAMVEVEDFVDPNGKISLQREETPSNRGESTVLSFVSWLTLSGPEQSSVRGPSTENQEAK
RMALDCIKQCDPEKMITESKFLQLESLQELMKALVSVTPDEETYDEEDAAFCLEMLLRIV
LENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAVVGLLRLAIRLLRREEISGQVLLSL
RILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSGDDWATLFTLLECIGSGVKPPAALQ
ATARADASDTGAQSDSELPSYHQNDVSLDRGYTSDSEVYTDHGRPGKIHRSATDADVVNS
GWLVVGKDDIDNAKPGSGPSRPGPSPLVNQYSLTVGLDLGPHDTKSLLKCVESLSFIVRD
AAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRSKSHKYDSKGNRFKKKSKEGSMLRRP
RTSSQHATRGGHSDEDEDEGVPASYHTVSLQVSQDLLDLMHTLHTRAASIYSSWAEEQRH
LETGGRKIEADSRTLWAHCWCPLLQGIACLCCDARRQVRMQALTYLQRALLVHDLQKLDA
LEWESCFNKVLFPLLTKLLENISPADIGGMEETRMRASTLLSKVFLQHLSPLLSLSTFAA
LWLTILDFMDKYMHAGSSDLLSEAIPESLKNMLLVMDTAEIFHSADTRGGSPSALWEITW
ERIDCFLPHLRDELFKQTVIQDPVPMEPHSQKPLISAHLAPAAGDTRTPGHPPAPEIPSE
LGACDLEKPDPRATSSSSPGSPVASSPSRLSPTPDGPTPLAQSPLILQPLASPLQVGVPP
MTLPIILNPALIEATSPVPLLATPRPTDPISTSEVN
NT seq 5691 nt   +upstreamnt  +downstreamnt
atggtagataagaatatttacatcattcaaggggagattaacattgtggttggggccatc
aaacgaaatgcccgatggagcacccatacaccactggatgaagaacgggatcctttgctg
catagtttcagtcatctcaaggaggttttaaacagtataacagaactctcagagattgag
cccaatgtatttcttcgtccttttctggaagtgattcgctctgaagataccactggccct
atcactggactggcgcttacctctgtcaacaagtttctgtcctatgcacttatagatcct
actcatgagggcacggcagagggaatggagaacatggcagatgctgttacccatgcccgt
tttgtgggcacagatcctgccagtgatgaagttgtcctgatgaaaatccttcaggttcta
cggactctgttgctaaccccagtaggtgcccacctaaccaatgaatctgtgtgtgaaatt
atgcagtcttgcttccggatctgttttgaaatgaggctcagtgagttattgagaaaatcc
gcagagcacactctcgtagacatggtgcagctgctcttcacaaggttacctcagtttaaa
gaagaacccaagaactatgttgggaccaacatgaaaaagatttctccatgtctcctcaac
aaactggagctaaatagtggggagcagaccaaagccctgaaccagttagagagggtacta
ctctttaagaacctcaagctgaaaatgagagcaggaggcatgagtgattcatccaaatgg
aagaaacagaagagatccccccggcccccgcgccatatgaccaaagtcatgccaagttca
gagctacccactcccaatggaaccaccttatcctctaacctcactggtggtatgcccttc
attgatgtgcccactcctgtctcctctgtgagttcagaagctgcctcagcagtggtcagc
ccctctacagatagtggccttgagttttcctctcagaccacctccaaggaagacctcact
gacctggaacaacctggctccccagggtacagcacagctgcagagcctgggagcagtgag
ctaggggtccttgaacagcctgacctccagacacagcaggaacgggcccatgtggaaaag
gcccagtcagcatccgtggaatccattcctgaagtgttagaggagtgtgcctccactgct
gaccactctgactctgcctctgtccatgacatggattatgtcaacccccggggtgtgcgt
tttacacagtcctcccagaaagaaggcacagccttagttccttatggtcttccctgcatt
cgcgagctcttccgcttccttatctccctcaccaatccacatgaccgccataactcagag
gttatgatccatatgggactgcatttgctgacagtggcactcgagtcagctcctgtagct
cagtgccagagcctcttgggcctcatcaaggatgagatgtgccgccacttattccagctg
ctcagtgtagagcgactgaacctttatgctgcttccctgcgagtatgcttcctactgttt
gagagtatgcgagagcaccttaagttccaactggagatgtacattaaaaagctcatggag
atcatcactgtggagaaccccaagatgccttatgagatgaaggagatggcactggaggcc
attgtgcagctgtggcgtatccctagctttgtcaccgagctttacatcaactatgattgt
gactactactgttcaaacctcttcgaagacctcaccaagctgctctccaagaatgccttc
cctgtatctggtcagctatatacaacacacctgctgtctcttgatgccctattgacagtg
atcgacagcactgaggcccactgccaggccaaagtcctcaatagcctcacccagcaggag
aagaaagaaccagccagagccagccatgaggcagtggatgtcatccgagaagctagcaat
actgagagagcaaccagtgatgggaaggctataggcctggccccagatgtcccaggcctg
catctgccaagtggagggcggctgtcaactgaacttggaaagccaggatgtggtgatctg
caggaagctggtgactctggggctgacaaaaagtttacccggaagccacctcgattttcc
tctctcctgccagatccacgggaactaattgaaattaaaaacaaaaagaagctgttaatc
actggcacagagcagtttaaccagaagccaaagaagggaatccagtttctgcaggagaaa
ggccttctcaccatccctatggacaacacagaggtagcccagtggctccgagagaaccct
cggttggacaagaaaatgattggagagtttgtgagtgaccgcaaaaacatcgacctgttg
gagagctttgtgagcaccttcagctttcaaggactgcgactggatgaggctctccgcctc
tacctggaagcttttcgtttgcctggggaagcaccagtcattcagaggttgctggaggca
ttcacagagcattggaggaattgtaatgggtccccatttgccaatagcgatgcctgcttt
gccctggcctatgctgtcatcatgcttaacactgaccagcacaaccataatgttcgcaaa
cagaatgcaccgatgactctggaggagtttcgcaaaaacctaaaaggtgtgaatggaggc
aaggactttgagcaggacatcctggaggacatgtaccatgccatcaagaatgaggagatt
gtgatgcccgaggagcagacaggcttggttcgggagaactatgtctggaatgttcttctt
catcgtggtgccactcctgagggaatattcctgcgtgttcctcctggcagctacgatctt
gatctcttcaccatgacttggggtcccactattgctgctctctcttatgtctttgacaaa
agccttgaggagacaatcatccagaaagccatctcgggcttcaggaaatgtgccatgatc
tccgcccactatggcctcagcgacgtgtttgacaatctcatcatctctctatgcaaattc
acagctctcagcagtgagtctattgagaacttgcccagtgtatttggaagcaaccctaag
gcccacattgcagccaaaacagttttccatttggctcatcgtcatggtgacatcctgcga
gagggctggaagaatatcatggaggccatgctacaactcttccgagctcaactgctaccc
aaggctatggtggaggtagaagattttgtggatcccaatggcaaaatttctctacaacga
gaagagacaccatcaaaccgaggagagtcgacagtgctgagctttgtgagttggctgaca
ctgagtggtccggagcagtctagtgtgcggggcccctccactgagaaccaagaggcaaag
agaatggcattggactgtatcaagcaatgcgaccctgaaaagatgatcacagaaagcaag
ttcctccagttggagtcactacaagagctcatgaaggctctggtctcagtgacaccagat
gaagagacatacgatgaggaagatgctgcgttctgtttggagatgctgctaaggattgtg
ctggaaaacagggatcgtgtgggctgtgtgtggcagactgttcgagatcatctgtatcac
ctttgtgtccaagcacaagacttctgcttccttgtggagcgagcagtagtagggttgctg
cgcctggccattcggctgctccgaagagaagagatcagtggccaggtattgctctccctg
cgtattttgctactgatgaagcccagcgtgctgtcccgagtcagccaccaggtcgcatat
gggctccatgaactccttaagaccaacgcagccaatatccactcgggcgatgactgggcc
accctcttcacgctgctggagtgcatcggctcaggtgtgaagcctccagcagctctgcag
gccacagccagggctgatgcatctgacactggggcccagtcagacagtgagctcccgtcc
taccatcaaaatgatgtgagcctggacagaggatacacttctgactcagaggtctacact
gaccatggcaggcctggcaagatacaccgatcagccacagatgctgatgtagtcaacagt
ggttggttagtggtggggaaagacgacattgacaatgccaagccaggctcaggacccagc
cggccaggcccttcacctctggtcaatcagtatagccttacagtggggctggatctgggg
ccacatgacacaaagtccctccttaagtgtgtggaatcgctgtccttcattgtacgtgac
gctgcccacatcacacctgacaactttgagctctgtgtcaagactctgcgcatctttgtg
gaagccagtctgaatggcggatgcaagtcccaggagaaacgtagcaagagtcacaaatat
gacagcaaagggaatcgcttcaagaagaaatccaaggagggctcaatgcttcggagacct
cgaacctctagccaacatgccacgcggggcgggcacagtgatgaagatgaggatgaaggt
gtgcccgccagctaccatacggtgtctttacaggtcagtcaggacttgctagacctgatg
cacaccctgcacacgcgggcagcttctatctacagctcatgggcggaggagcaacgccat
ctggagacaggtggccggaagatcgaagcagattcacgcacgctctgggcccactgctgg
tgccctttactacagggcattgcctgcctgtgctgtgatgcccggcgccaggtgcggatg
caggcactaacctatctgcagcgggcactactggtacatgatctgcaaaaacttgatgcc
ctggagtgggagtcctgctttaataaggtgctgtttcctctattgaccaagctcttggag
aacattagccctgcagatatcggtgggatggaggagacccggatgagggcttccacactg
ctctctaaggtcttcctgcagcacctgtctccactgctgtccctctctacctttgcggcc
ctctggctcaccatcctggacttcatggacaagtacatgcatgcaggctccagtgactta
ctgtcagaggccatccctgagtctctgaagaacatgcttctggtgatggacacagcggag
attttccacagcgcagacacacgaggaggcagcccctcagccctctgggagatcacctgg
gagcgcattgactgtttcctgccccacctacgagatgagctctttaagcagactgtcatc
caggaccccgttcccatggagcctcacagccaaaaacctctgatctccgcccacctggct
cctgctgctggtgacaccaggacacctggccacccacctgccccagagataccctctgag
ctgggggcctgtgacttggagaagcctgacccacgagccaccagcagcagctccccggga
tcaccagtggcctctagccccagcaggctgagccctaccccagatgggccaacgccactg
gctcagtcccctctgatcctacaacccttggcctccccactgcaggttggcgtgccaccc
atgactctgcctatcattctcaaccctgcactcattgaagccacctctccggtgcccctc
ctggccactccacgccccacagaccccatatccacctccgaggtcaactaa

KEGG   Oryctolagus cuniculus (rabbit): 100345151
Entry
100345151         CDS       T03373                                 
Symbol
ARFGEF1
Name
(RefSeq) ADP ribosylation factor guanine nucleotide exchange factor 1
  KO
K18442  brefeldin A-inhibited guanine nucleotide-exchange protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100345151 (ARFGEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345151 (ARFGEF1)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    100345151 (ARFGEF1)
SSDB
Motif
Pfam: Sec7 BIG2_C Sec7_N DCB DUF1981
Other DBs
NCBI-GeneID: 100345151
NCBI-ProteinID: XP_017196869
Ensembl: ENSOCUG00000015867
LinkDB
Position
3:complement(83029011..83177785)
AA seq 1848 aa
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKAETEKQSPPHGEAKA
GSSTLPPVKSKANFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGNAPDST
TPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKVLLTAEHHTHRIHEGTVQQGVRTCSNI
FLSSNNLINQTTAKGTLTQMLNVIFAPHGNQALQEAKQMEKERHRQHHHLLQSPLSHHEP
ESPQLRYLPPQTVDHIAQEHDGDLDPNAHDVDKSLQDDTEPENGSDISSAENEQTEADQA
TAAETLSKNDILYDGENQDCEEKPQDIVQSIVEEMVNIIVGDMGEGTTINASTDGNIGAL
EDGSDSENIQANGIPGTPISVVYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKFSHILQK
DAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPVFRTNEMFINAI
KQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTSS
FDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMS
NVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPSEQEMSEIKHPETINR
YGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQ
EQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSAL
RMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSP
QVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELTIPTKSSKQNV
ASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFS
VGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQK
NIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSLT
GTKDQAPDEFVGLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIV
DFVRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCN
PNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCIA
QMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTLVFEKHFPATIDSFQ
DAVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFKEYTSDDMNVAPEDRVWVRG
WFPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGNTYEKHWWQDLFRIVFRIFDNMKLP
EQQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEQLARSGT
NCLENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHALLTWRPTSGETAPPPTSPVSEKQ
LDTISQKSVDIHDSIQPRSADNRQQAPLVSVSTVNEEASKIKSTAKFPEQKLFAALLIKC
VVQLELIQTIDNIVFFPATSKKEDAENLAAAQRDAVDFDVRVDTQDQGMYRFLTSQQLFK
LLDCLLESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYMDE
NRVSAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDNRFKAHAS
FYYPLLCEIMQFDLIPELRAVLRRFFLRIGVVFQISQPPEQELGLNKQ
NT seq 5547 nt   +upstreamnt  +downstreamnt
atgtatgaggggaagaagacgaagaacatgttcctgacccgggccctggagaagattttg
gccgacaaggaagtgaagaaggcgcatcactcccagctgcgcaaagcttgcgaggtggcg
ttagaggaaataaaagctgaaactgaaaaacagagtcctcctcatggagaagcaaaagct
ggatcaagcacccttccaccagtgaaatcaaaggcaaattttattgaagcagacaagtac
ttcctaccctttgagttggcatgccagtccaaatgtccccgtatagtcagtacatcttta
gattgtttacagaaacttatcgcttatgggcacttgactggcaatgctccagatagcaca
acgccaggcaaaaaattaattgataggattattgaaactatttgtggttgcttccaaggt
cctcagacagatgaaggagttcagttgcagataataaaggtattacttactgcagaacat
cacacacatagaattcacgagggaactgtacagcaaggtgtgagaacatgctccaatatc
tttctgtcaagcaataatctcatcaatcagacaacagccaaggggactcttactcagatg
ctaaatgttatctttgcaccgcatggaaaccaagcattgcaggaagccaagcaaatggaa
aaagaaaggcatcgacaacatcatcatctgttgcagtctccactaagccatcatgagcct
gaatcacctcagcttagatacttgccacctcagactgttgatcatatagcccaggaacat
gacggggaccttgaccccaatgcacatgatgtggataaaagtcttcaggatgacacagag
cctgaaaacggatctgatatttccagtgcagaaaatgaacagactgaagctgatcaggca
actgcagctgaaacattatctaaaaatgatatattgtatgacggagaaaaccaagactgt
gaggaaaagccacaagacattgtacagagcattgtagaagaaatggtgaacatcattgtt
ggagatatgggagaagggactactataaatgcaagtacagatggaaacattggagcttta
gaggatgggagcgacagtgaaaatattcaagcaaatggaattccaggaacaccaatttct
gttgtgtatacaccatccttacctgatgacagattgtctgtctcttccaatgatactcag
gaatctggaaattcttcaggaccctcacctggtgctaagttttcccacattttacaaaag
gatgcctttctagtattcaggtcattgtgtaaactgtcaatgaaaccactgtcagatgga
ccaccagatccaaagtctcatgagttacgatccaagattctttcattgcagttacttcta
tccatcctgcagaatgcaggacctgttttcaggacaaatgagatgtttattaatgctatt
aagcagtatctgtgtgttgcactctcaaagaatggagtctcatctgttccagaagttttt
gaactttccctttccatatttcttactttgttgtcaaactttaagacgcatctgaagatg
caaattgaggtgttctttaaagaaatttttctatatattttggaaacttctactagctca
tttgatcataaatggatggttattcagacactgacaaggatttgtgcagatgctcagagt
gtagtggatatttatgtaaattatgactgtgacttaaacgcagcaaatatatttgaaaga
ttagtaaacgacctatcaaaaattgctcaaggaaggggcagtcaagaacttggtatgagt
aatgttcaggaattgagcctgcggaaaaaaggattagagtgcttagtgtcaattctgaag
tgtatggttgaatggagtaaggatcagtatgtgaatcccaactctcaaacaactcttggc
caggaaaaaccctcagagcaagagatgagtgaaataaagcaccctgagacaataaacaga
tatggaagtttaaattccctggagtcaacatcatcatcaggaataggcagctacagtaca
cagatgtctggcactgataatccagaacaatttgaggtcctaaagcaacaaaaagaaata
atagaacaagggatagatctatttaataagaaaccaaagagaggaatacagtacctccaa
gaacaagggatgcttgggaccactcctgaagatattgcccaattcttacatcaagaggaa
agattagattctactcaagtgggtgaattcctgggagataatgataaatttaacaaagaa
gtcatgtatgcatatgtagaccaacatgacttctctggaaaagactttgtttctgctctt
cgcatgtttctagaaggatttcgtcttccaggggaagctcagaaaattgatcggttaatg
gaaaaatttgctgcacgatacctagaatgcaaccaagggcaaactctttttgctagtgcg
gatactgcttatgttttggcttactcaattatcatgttgaccacagaccttcacagtcca
caggttaaaaataaaatgacaaaggaacagtatattaagatgaatagaggtatcaatgac
agtaaagaccttcctgaagaatatctatcagccatctataacgagatagctgggaaaaaa
atatcaatgaaagaaacgaaagaactgacaatccctacaaaatcaagtaaacaaaatgta
gccagtgaaaaacaaagaagacttctgtataacttggaaatggaacagatggccaagaca
gcgaaagcactcatggaggcagtgagccatgttcaggcaccttttacaagtgcgacacat
ttggagcatgtgagacccatgtttaagttggcttggacaccttttctggctgcatttagt
gtaggtctccaagattgtgatgatactgaagtggcctctctctgcctggaaggtatcaga
tgtgcaatcagaattgcatgcattttcagcattcagctcgaaagagatgcatatgtccag
gcactggcaagatttactttactaacagtgagttctggtattactgaaatgaaacagaag
aacattgacaccataaaaacacttatcacggtggctcatacagatggaaattatttagga
aattcgtggcatgagattctgaagtgcatcagtcagttggagctggcacagcttatagga
accggagtaaaacctcgatacatttctggaacagtgcgaggcagagaaggatctcttact
ggaacaaaagatcaggctcctgatgaatttgtgggtctagggttagttggaggaaatgtg
gactggaagcagatagcaagtattcaggaatccattggagaaaccagttctcaaagtgtt
gttgttgctgtagatagaattttcacaggatctacaagactagatggaaatgctattgtg
gatttcgtccgatggctatgtgctgtgtctatggatgaattgctttctaccacacatcca
agaatgttcagtctgcaaaaaatagttgaaatatcatattacaacatgggaagaataaga
ttgcagtggtcccgaatttgggaagttattggagatcattttaataaggttggctgtaat
cctaatgaagatgtagctatttttgcagtagattccttgagacaattgtcaatgaaattt
ttagagaaaggagagcttgctaatttcagattccagaaggatttcttaagaccttttgaa
catataatgaagcggaacaggtctccaacaattcgagatatggttgtgcggtgtatagca
cagatggttaattctcaagctgctaacattcggtctggatggaagaacattttctctgta
tttcatctagctgcatctgatcaagatgaaagcatagtagaacttgcatttcaaacaaca
gggcacattgtcacccttgtatttgaaaaacactttccagcgactattgattctttccag
gatgcagtgaagtgtttgtctgaatttgcgtgcaatgcagcttttccagatacaagtatg
gaagcaattcgacttattcgccattgtgcaaaatatgtgtctgatagacctcaggctttc
aaggaatacacaagtgacgatatgaatgtggcacctgaagacagagtgtgggtgagagga
tggttcccaattctctttgagttatcctgtatcatcaacagatgcaaattagatgtaaga
accaggggtttaacagtgatgtttgaaataatgaaaacatatggcaacacttacgaaaaa
cactggtggcaggatttatttagaattgtttttagaatctttgacaatatgaaattgcca
gaacagcagacagagaaagctgaatggatgacaacaacttgcaaccatgcactttatgca
atctgtgatgtgttcacccagtatttagaagtactcagtgatgtacttttggatgatatt
tttgcccagctttactggtgtgtgcagcaagacaatgaacagttagcacgatctggtaca
aactgcttagagaatgtcgttattctgaatggtgaaaaatttaccctagaaatctgggat
aaaacttgtaactgcacattggatatcttcaaaactacaatcccacatgcgctcttgacc
tggcgtcccacttctggagaaactgctcccccacctacatctcctgtgagtgaaaaacag
ttggatacaatatcacagaaatctgtagatatccatgattccattcagccacgatctgca
gataatagacagcaagcaccattggtttctgtctctactgtaaatgaagaagccagcaaa
attaaatctacagcaaaatttccagaacaaaaattgtttgctgccctgttgattaaatgt
gttgtgcagctggaactcatccagactatcgacaacatcgtgttcttcccagccacaagt
aagaaggaagatgcggaaaacctagctgcagcgcagagagatgcagtggactttgatgtt
cgagttgatactcaagaccaaggaatgtatcgcttcctaacatcccagcaactttttaag
ctactggactgcttgttagagtcgcatagatttgcaaaagcatttaattccaacaacgaa
caaaggactgctctgtggaaagcaggcttcaaaggcaagtctaagcccaaccttctgaag
caggaaacaagcagcctggcctgtgggctgcgcattctcttccggatgtacatggacgag
aaccgggtcagtgcctgggaggaggtccagcagaggcttttaaacgtctgcagtgaagca
ctcagttacttcctcactctaacatcagaaagtcaccgggaagcctggactaacttactg
ctgctgtttctaacaaaagttctaaagatcagtgataacaggtttaaagctcatgcatca
ttctactaccctctgttatgtgaaatcatgcagtttgacttgattcctgaacttcgtgct
gttcttagaagattttttctgcgaattggagtagtttttcagatatcacaaccacctgaa
caggaacttggactaaacaagcagtga

KEGG   Oryctolagus cuniculus (rabbit): 100345562
Entry
100345562         CDS       T03373                                 
Symbol
CYTH1
Name
(RefSeq) cytohesin 1
  KO
K18441  cytohesin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100345562 (CYTH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100345562 (CYTH1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100345562 (CYTH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345562 (CYTH1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100345562 (CYTH1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    100345562 (CYTH1)
SSDB
Motif
Pfam: Sec7 PH PH_11 PH_20 PH_8 PH_3 Pilosulin
Other DBs
NCBI-GeneID: 100345562
NCBI-ProteinID: XP_008250740
Ensembl: ENSOCUG00000008965
LinkDB
Position
Un
AA seq 339 aa
MQRNKQVAMGRKKFNMDPKKGIQFLIESDLLKGSCEDLAQFLYKGEGLSKTAIGDYLGER
DEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGV
FQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESI
KNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDK
EPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISA
PTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgcagaggaacaaacaggtagccatgggcaggaagaaatttaacatggaccctaaaaag
ggcatccagttcctgatagagagcgacctgctgaagggctcatgcgaggacctcgcgcag
ttcctgtacaagggcgaagggctcagcaagacggccatcggcgactacctgggggagaga
gatgagttcaacatccaggttcttcatgcgttcgtggagctgcatgagttcacggatctg
aacctggtccaggcgctgcggcagttcctgtggagtttccggctccctggagaggcccag
aagatcgaccggatgatggaggccttcgcgcagcggtactgccagtgcaaccccggggtg
ttccagtccacggacacttgctacgtcctctcctttgccatcatcatgttgaacacgagc
ctgcacaaccccaacgtcaaagataagcccaccgtggagaggttcattgccatgaaccga
ggcatcaacgacggaggcgacctgcccgaggagctgctccggaatctgtatgagagcata
aaaaatgaaccctttaaaatcccagaggatgatgggaatgacctcactcacaccttcttc
aatccagaccgagaaggctggctgctgaagctcggaggtggcagggtcaagacttggaag
agacgctggttcatcctgacagacaactgcctttactacttcgaatacaccacggataag
gagccccgtgggattatcccgctcgagaatctgagtatccgggaggtggaagactccaaa
aaaccaaactgttttgagctctacatccctgacaataaagaccaggtgatcaaggcctgc
aagacagaggccgacggccgcgtggtggaagggaaccacaccgtgtaccggatctcagcc
ccgacgcccgaggagaaggaggagtggatcaagtgcatcaaagcggccatcagcagggac
cctttctacgagatgctggcggcgcggaagaagaaggtgtcctccaccaaaaggcactga

KEGG   Oryctolagus cuniculus (rabbit): 100349388
Entry
100349388         CDS       T03373                                 
Symbol
PSD2
Name
(RefSeq) pleckstrin and Sec7 domain containing 2
  KO
K12494  PH and SEC7 domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100349388 (PSD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100349388 (PSD2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100349388 (PSD2)
SSDB
Motif
Pfam: Sec7 PH_9 PH
Other DBs
NCBI-GeneID: 100349388
NCBI-ProteinID: XP_008253336
Ensembl: ENSOCUG00000026563
LinkDB
Position
3:21934852..21985001
AA seq 767 aa
MDEDSLPPSLPEEGNAAGDSSLEPEEAPGVQPDEDLSCSLGSPGHKERGCLGHTEEPAED
QDGAPHSLSLDLSLTNGLAPGQDSNILEGGTEPRPWRAGGLAGGHDADTEDPQLGXVGXG
EPDVRDGFSXTFEKILESELLRGXQYSSLDSLDALSLTDESDSCVSFEAPLTPLIQQRAR
DSPEPGAGLGIGDMGPEGDMGAAGGEGELGSPLRRSISCSRSENVLSRLSVTAVPNGFHE
DGPPGPGGEEEEEEEEEEDTDKLLNSASDPSLKDGLSDSDSELSSSEGLEPGGTDPLANG
CQGMSEAARRLARRLFHLEGFQRCDVARQLGKNNDFSRLVAGEYLSFFDFSGLTLDRALR
TFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDLHGHNIG
KKMSCQQFIANLDQLNDGQDFAKDLLKSLYNSIKNEKLEWAIDEDELRKSLSELVDDKFG
TGTKKVTRILDGGNPFLDVPQALSATTYKHXVLTRKTHADMDGKRTPRGRRGWKKFYAVL
KGTILYLQKDEYRPDKALSEGDLKNAIRVHHALATRASDYSKKSHVLKLKTADWRVFLFQ
APSKEEMLSWILRINLVAAIFSAPAFPAAVSSMKKFCRPLLPSCTTRLCQEEQLRSHENK
LRQVTAELAEHRGHPVERGVKSKEAEECRLKEHYLTFEKSRYETYIHLLSVKIKVGSDDL
ERIEARLATLEGDDPALRKTHSSPALSQSHGPVTGSKATKDATGSDT
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggacgaggacagtctccctccctccctgcccgaggaaggcaatgctgccggggactcc
agcctggagcctgaagaagcacctggggtccaacccgacgaggacctgagctgcagcctt
ggcagcccagggcacaaggaaagaggatgcctggggcacacagaggagcctgcagaggac
caggacggggccccccacagcctcagccttgacctctccctcaccaatggcttagctccg
ggacaagactcaaacattctggaaggtggcacagagcccaggccctggagggctggtggg
ctggcgggagggcacgatgctgacacggaggaccctcagctggggtaagtgggnnntggg
gagccagatgtacgggacggtttcagcngcacgtttgagaagattctggaatcagagctg
ctgcggggcnaccagtacagcagcctcgactccctggatgcgctgagcctcacggacgag
agtgacagctgtgtcagctttgaggctcctctcacacccctgatccagcaacgggcccgt
gacagccctgagccgggggccgggctgggcattggggacatggggcccgagggggacatg
ggggcagctggtggtgagggagagctgggcagccccctgcggcgctccatctcctgcagc
cgctcagagaatgtcctgagccgcctgtctgtcacggccgtgcccaatggattccatgaa
gatgggcccccgggcccaggcggggaggaggaggaagaggaggaggaagaggaggacaca
gacaagttgctgaactcagccagcgaccccagcctgaaggacggcctgtcggattcggac
tcggagctgagcagctcggaggggctggagcctggcggcacagaccctctggccaacggg
tgccagggcatgagcgaggctgctcgccggctggcccgccgcctcttccacctggagggc
ttccagcgctgtgacgtggcccggcagctgggcaagaacaacgatttcagcaggctggtg
gctggggaatacctcagtttcttcgacttctcgggcctgactctggaccgagcgctcagg
accttcctgaaggccttccctctaatgggagagacccaggagcgtgagcgggtgctcaca
cacttctcccgccggtactgccagtgcaaccctgacgacagcacctcggaagacgggatc
cacacgctcacctgcgcgctgatgctgctcaacacagacctgcacggccacaatattggt
aagaagatgtcctgccaacagttcattgccaacttggaccagctgaatgatggccaagac
tttgccaaagatctgctgaagtccctttacaactccatcaagaatgaaaagctggaatgg
gccattgatgaggacgagctgaggaagtccctgtctgagctggtggatgacaagtttggg
acaggcacgaagaaggtgacacggatcctggatggtggcaaccctttcctggatgtccca
caggctctcagcgccaccacctacaagcatngcgtgctcacccggaagacccacgccgac
atggatggcaagaggacgccccgtgggaggcgtggctggaagaaattctacgcggtgctc
aaagggaccatcctgtacttacagaaggatgagtacaggcctgacaaagcactgtcggag
ggcgacctgaagaacgccattcgcgtgcaccacgccctggccaccagggcctctgactac
agcaagaagtctcatgtgctgaagctgaagacagccgactggagggtcttcctcttccag
gcaccgagcaaggaggaaatgctctcctggatcctgaggatcaacctggtggctgccatc
ttctccgccccggccttcccagctgccgtcagctccatgaagaagttctgccggcccctg
ctgccctcctgcaccacgcgcctctgccaggaggagcagctgcggtctcacgagaacaag
ctgaggcaggtgactgcagagctggcagagcacaggggtcaccccgtggagaggggcgtc
aagtccaaggaggccgaggagtgccggctgaaggagcactatctcacattcgagaaaagc
cgttatgagacctacatccacctcctgtctgtgaaaatcaaggtgggctcggatgatctg
gagcggattgaggcccgcctggccaccctggaaggggacgaccctgctcttcggaagaca
cactcaagccctgccctcagccagagccacgggcctgtgactggcagcaaagccacaaag
gatgccactgggtccgatacttag

KEGG   Oryctolagus cuniculus (rabbit): 100350140
Entry
100350140         CDS       T03373                                 
Symbol
CYTH2
Name
(RefSeq) cytohesin 2
  KO
K18441  cytohesin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100350140 (CYTH2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100350140 (CYTH2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100350140 (CYTH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100350140 (CYTH2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100350140 (CYTH2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    100350140 (CYTH2)
SSDB
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 PH_20 NUDE_C
Other DBs
NCBI-GeneID: 100350140
NCBI-ProteinID: XP_008250643
Ensembl: ENSOCUG00000009001
LinkDB
Position
Un
AA seq 400 aa
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCTPGSFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRSLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKKEADGRVVEGNHMVYRISAPT
QEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggaggacggcgtctacgaacccccagacctgacgccggaggagcggatggagctggag
aacatccgacggcggaagcaggagctgctcgtggagatccagcgcctgcgggaggagctc
agcgaggccatgagcgaggtggaggggctggaggccaacgagggcagtaagaccttgcag
cggaaccggaagatggcaatgggcaggaagaagttcaacatggaccccaagaaggggatc
cagttcttggtggagaatgaacttctgcagaatacccccgaggagatcgcccgcttcctg
tacaagggtgaggggctgaacaagacagccatcggggactacctgggggagagggaggag
ctgaacctggccgtgctccatgcttttgtggatctgcatgagttcaccgacctcaatctg
gtgcaggccctcaggcagtttctgtggagctttcgcctccctggggaggcccagaagatt
gaccgaatgatggaggcctttgcccagcgctactgcctgtgcactcctggaagcttccag
tccacagacacctgctacgtgctgtccttcgcggtgatcatgctgaacaccagcctgcac
aaccccaacgtgcgcgacaagccgggcctcgagcgcttcgtggccatgaaccggggcatc
aacgagggcggggacctgcccgaggagctgctgaggagcctctatgacagcatccgcaac
gagcccttcaagatccccgaggacgacggcaacgacctgacccacaccttcttcaacccg
gaccgcgagggctggctcctgaagctgggagggggccgggtgaagacgtggaagcggcgc
tggttcatcctcacagacaactgcctctactacttcgagtacacgacggacaaggagccc
cgcggaatcatcccgctggagaacctgagcatccgtgaggtggacgacccccggaagccg
aactgcttcgagctctacatccccaacaacaaggggcagctcatcaaagcgtgcaaaaag
gaggcggacggccgcgtggtggagggcaaccacatggtgtaccgcatctcggcgcccacc
caggaggagaaggacgagtggatcaagtccatccaggcggcagtgagcgtggaccccttc
tacgagatgctggcggcgaggaagaagcggatatctgtcaagaagaagcaggagcagccc
tga

KEGG   Oryctolagus cuniculus (rabbit): 100352582
Entry
100352582         CDS       T03373                                 
Symbol
IQSEC3
Name
(RefSeq) IQ motif and Sec7 domain 3
  KO
K12495  IQ motif and SEC7 domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100352582 (IQSEC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100352582 (IQSEC3)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100352582 (IQSEC3)
SSDB
Motif
Pfam: IQ_SEC7_PH Sec7 PH_19 bZIP_1 DivIC bZIP_2 IQ
Other DBs
NCBI-GeneID: 100352582
NCBI-ProteinID: XP_002712833
Ensembl: ENSOCUG00000004863
UniProt: G1SMP0
LinkDB
Position
8:complement(37507800..37613652)
AA seq 1202 aa
MESLLENPVRAVLYLKELTAIVQNQQSLIHTQRQRIDELERRLDELSAENRSLGEQQQRL
QAQPPPGPVAPSPAPPPASPVAVPASAAAGAQEPLQDHGQRAPSAPEPPALQHHGQLLVQ
PQPGPSSRAQAPQSPQQPAGTLSAGAHKDKERPSSCCAAAGALLQHKSPAALGKGVLGRR
PENETVLHQFCCPAADAEQKPACSDLASQSDGSCAQAGGGMEDSVVAAAAVAAGRPSAHA
PKAQAQELQEEEERPGAGGGSPRAGPQHVASPGRQQPALATAPCSHAPAASDYELSLDLK
NKQIEMLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRA
PMAESLAAEKAFMEGCGLVGLPLGRSPSLPPSLAGALTELEDSFSEQVQSLAKSIDDALS
TWSLKTMCSLQESGAYQIHQALRAGAGPPGLEAESRELSGAGPGPGEEAAEAGGLPQGHS
GTLMMAFRDVTVQIASQNISVSSSTALSVANCLGAQAAPAAAEPSESANEEGEHPGQEAP
ETPPAGQGDAPAEDPRAEAGTALPGAAEAVAEEAAAVEAQEEEEEEEESGEACRAAEAEA
DVGDHSEQLSSSSTSTKSAKSGSEASATASKEALQAMILSLPRYHCENPASCKSPTLSTD
TLRKRLYRIGLNLFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNS
KKQFNRDVLDCVVDEMDFSSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPE
VVQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVV
GIYERIQQKELKSNEDHVTYVTKVEKSIVGMKTVLSVPHRRLVCCSRLFEVTDVNKLQKQ
AAHQREVFLFNDLLVILKLCPKKKSSSTYTFCKSVGLLGMQFHLFENEYYSHGITLVTPL
SGSEKKQVLHFCALGSDEMQKFVEDLKESIAEVTELEQVRIEWELEKQRGTKTLSFRSGG
AQADSQSKQGSPTAKREAAVGEKPAESPVEVSIHNRLQSSQHSSGLGAERGVPVPPQPDL
QPSPAREQPPPPTPLPPPPPPPPPTPPGTLVQCQQIVKVIVLDKPCLARMEPLLSQALSC
YASSSSDSCGSTPLGGPGSPVKVIHQPPLPPPPPPYNHPHQFCPPGSLLHRRRYSSGSRS
LV
NT seq 3609 nt   +upstreamnt  +downstreamnt
atggagagcctgctggagaacccggtgcgggccgtgctctacctcaaggagctcacggcc
atcgtgcagaaccagcagagcctcatccacacgcagcgccagcgcatcgacgagctggag
cggaggctggacgagctgagcgccgagaaccgcagcctgggtgagcagcagcagcggctg
caagctcagcctccgcccgggcccgtggccccgtcgccagccccgccaccggcatcccct
gtcgccgttcccgcctccgccgccgccggggcccaggagcctctccaggaccacggacag
cgcgcgccctctgcgcctgagccgccggcgcttcagcaccacgggcagctcctggtgcag
ccccaaccaggccccagcagcagggctcaggcaccgcagtcgccccagcagcctgcgggg
acgctctcggccggcgcccacaaggacaaggagcgtccctcgagttgctgcgccgccgcc
ggagccctccttcaacacaaatcccccgccgccctaggcaagggcgtcctgggcaggaga
cccgagaatgagactgtgctgcaccagttctgctgcccagctgccgatgccgagcagaag
cctgcctgctctgacctggcctcccaaagtgatggctcctgcgcccaggccggtgggggc
atggaggactccgtggtggcagcggcagcggtggcagccggcagacccagtgcccatgcc
ccgaaggctcaagcccaggagctgcaggaggaggaggagcggccaggggcagggggtggc
tcccccagggccggcccccagcacgtggcctcccctggtcggcagcagcctgccctggcg
acggcgccctgctcccacgcccctgcagcctccgattacgaactctcccttgacctaaag
aataaacagattgaaatgctagaacacaagtacgggggccacctggtatcccggcgcgcc
gcctgcaccatccaaaccgccttccgccagtaccagctcagcaagaacttcgagaagatc
cgcaactcgctcctggagagccgcctgccgcggcgcatctccctgcgcaaggtgcgggcg
cccatggccgagagcctggcggccgagaaggcgttcatggagggctgcggcctcgtgggg
ctgccgctgggacgctcgccctccctgccgcccagcctggcgggcgcgctcaccgagctg
gaggactccttcagtgagcaggtgcagtccctggccaagtccatcgacgacgccctcagc
acctggagcctcaagaccatgtgctccctgcaggagagcggtgcataccagatccaccag
gccctgcgcgccggcgcggggccgccgggcctggaggccgagagccgggagctttccgga
gcgggcccagggcccggggaggaggccgccgaagctgggggcctgccccagggccacagc
ggcaccctcatgatggcgtttcgggacgtcacggtgcagatcgccagccagaacatctct
gtctcctcgtccacggccctgtcggtggccaactgcctgggcgcgcaggctgccccggcc
gccgcagagccctcggagagcgccaacgaggagggcgagcatcccgggcaggaggcccca
gagacgccccctgcgggtcagggggacgcgcccgccgaggacccgcgagcagaggcaggg
acggccctgccaggggccgcagaggccgtggcggaggaagccgcagcagtggaggcccag
gaggaagaggaggaggaagaagagtcaggggaagcgtgcagagcggctgaggccgaggcg
gatgtaggcgaccactcggagcagctgagcagcagtagcacatccaccaaatcggccaag
tcgggctccgaggcctcggcgaccgcttccaaagaggcgctgcaggccatgatcctgagc
ctgccccggtaccactgcgagaatccggccagctgcaagtcgcccacgctctccaccgac
acgctgcgcaagcggctctaccgcattggcctcaacctcttcaacataaacccggacaag
ggcatccagttcctgatctcgcgcggcttcatccccgacacccccatcggcgtggcccac
ttcctcctgcagcgtaagggcctcagccgccagatgatcggagagttcctgggcaacagc
aagaagcagttcaaccgggacgtccttgactgcgtggtggacgagatggacttctccagc
atggagctggacgaggccctgcgcaagttccaggctcacatccgcgtgcaaggagaggcc
cagaaggtggagcggctcatcgaggccttcagccagcgctactgcatgtgcaaccccgag
gtggtgcagcagttccacaaccccgacaccatcttcatcctggcctttgccatcatcctc
ctcaacaccgacatgtacagccccaacatcaagcccgaccgcaagatgatgctggaggac
ttcatccgcaacctgcgaggtgttgatgatggtgctgacatccccagggagctggtggtg
ggcatctacgaaaggatacagcagaaggagctcaagtccaatgaggaccacgtcacatat
gtcaccaaggtggagaagtccatcgtgggcatgaagacagtgctgtctgtgccgcaccgc
cgcctggtctgctgcagccggctcttcgaggtgactgacgtgaacaagctgcagaagcag
gcagcgcatcaaagggaggtgttcctcttcaacgacctgctggtgattctcaaactctgc
ccgaagaagaagagctcctccacctacaccttctgcaagtcggtcggcctgctgggcatg
cagttccacctcttcgagaacgagtattactctcacggcatcacactggtgaccccgctg
tccggctctgagaagaagcaggtgctgcatttctgtgccctgggctccgacgagatgcag
aagttcgtggaggacctgaaggagtccattgccgaggtgacggagctggagcaggtccgg
atagagtgggagctggagaagcagcgaggaacaaagacgctctccttcaggtccggggga
gcccaggcagactcacagtcgaagcaaggatcgcctacagccaaaagggaagcggccgtc
ggggagaagccagcggagagcccggtggaggtgtcaattcacaacaggcttcaatcgtcc
cagcacagctccgggctgggggccgagaggggcgtgccggtaccaccgcagccagacctg
cagcctagcccggccagagagcagcccccgccacccacaccgctgccgccgccgccgccg
ccgccaccacccactcccccaggcacgctggtgcagtgccagcaaatcgtcaaggtcatt
gtcctggacaagccctgcttggcccgcatggaacccctgctgagccaggccctctcctgc
tacgcctcatcctcctccgactcctgcggctccacacccctgggcggcccaggctccccg
gtcaaggtcatccaccagcctccgctgcccccacccccacccccttacaaccacccccac
cagttctgcccacccggctccctgctgcaccggcgccgctactccagcggctccaggagc
ctggtgtag

KEGG   Oryctolagus cuniculus (rabbit): 100353775
Entry
100353775         CDS       T03373                                 
Symbol
IQSEC1
Name
(RefSeq) IQ motif and Sec7 domain 1
  KO
K12495  IQ motif and SEC7 domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100353775 (IQSEC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100353775 (IQSEC1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100353775 (IQSEC1)
SSDB
Motif
Pfam: IQ_SEC7_PH Sec7 PH_19
Other DBs
NCBI-GeneID: 100353775
NCBI-ProteinID: XP_002713173
Ensembl: ENSOCUG00000001343
LinkDB
Position
9:5302681..5415091
AA seq 963 aa
MWCLHCNSERTQSLLELELDSGVEGEAPSSETGTSLDSPSAYHQGPLLPGSSLSPDHYEH
TSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQ
VEMLERKYGGRLVTRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFS
FEGPEKVHSSYFEGKQVSVTNDGSQLGALVPPECGDLGEPSTLKSPAPSSDFADAITELE
DAFSRQVKSLAESIDDALNCRSLHTEEAPVPEVVRARDSEPKPPLHSMDHHKLDEMTASY
SDVTLYIDEEELSPPLPISQVGDRPSSTESDLRLRAGGMAQDYWALAHKDDKVDTDTSCR
STPSLERQEQRLRVEHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLAGQQGSPKH
GPHSGPPKVLSREEPDLRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSN
DTINCSSESSSRDSLREQTLSKQTYHKETRNSWDSPAFSNDVIRKRHYRIGLNLFNKKPE
KGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFS
AMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAII
LLNTDMYSPNVKPERKMKLEDFVKNLRGVDDGEDIPREMLIGIYERIRKRELKTNEDHVS
QVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFL
FNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAVPGADIKVLI
NFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGNG
TLGRACLDDSYTSGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEFQPFEPLQPPV
LCS
NT seq 2892 nt   +upstreamnt  +downstreamnt
atgtggtgcctgcactgcaactccgagaggacccagtccctactggagctggagcttgac
agcggtgtcgagggtgaggcccccagcagtgagaccggcacatccctggacagcccctca
gcctaccaccagggccccctgttgcctggttccagcctgagcccggaccactacgagcac
acgtctgtgggagcctatgggctgtactcggggccgccgggacagcagcagcgcaccagg
aggcccaagctgcagcactcgacctccatcctgcgaaagcaggccgaggaggaggccatc
aagcgctcgcggtcactctctgagagctatgaactctcctcggacctgcaggacaagcag
gtggagatgctagaacgcaagtatggggggcgcctcgtgacccgccatgcggcccgcacc
atccagacggcgttccgccagtaccagatgaataagaacttcgagcgcctgcgcagctcc
atgtcggagaaccgcatgtcgcgccggatcgtgctgtccaacatgaggatgcagttctct
tttgaggggcctgagaaagtgcacagctcctacttcgagggcaagcaggtctccgtgacc
aatgacggctcccagctgggggccctggtgccccctgagtgtggcgaccttggtgagccg
tccacactcaagtctccagccccttccagcgactttgcggacgccatcacggagctggag
gacgccttctctcggcaggtgaagtcgctggctgagtccatcgatgatgccctgaactgc
cgcagcctgcacacagaggaggcgccggttcccgaggtggtgcgggcccgggacagcgag
cccaagccacccctgcacagcatggaccaccacaaactggatgagatgacagcctcctac
agtgacgtcaccctgtacatcgatgaggaggagctgtcaccacccctgcccatctcgcag
gtcggggaccggccctccagcactgagtcggacctgaggctgcgggctgggggcatggcc
caggactactgggccctggctcacaaggacgacaaggtggacacggacacaagctgccgc
agcacgccctcgctggagcggcaggagcagcggctgcgggtggaacacctcccgctgctc
accattgaaccccccagcgacagctctgtggacctcagcgaccgctcggaacgtggctca
ctcaagaggcagagtgcctatgagcgcagcctcgctgggcagcaaggcagccctaagcat
ggcccccacagtggtccccccaaggtcctctcccgagaggagcccgatctgcggccccgg
ccccccagacctctcgacagccacctagccattaatggttctgccaatcggcagagcaag
tctgagtcagattactcagatggggacaatgacagcatcaacagcacatccaactccaac
gacaccatcaactgcagctccgagtcgtcatctcgcgacagcctgcgggagcagacgctc
agcaagcagacctaccacaaggagacgcgcaacagctgggactcgcccgccttcagcaac
gacgtcatccgcaagaggcactaccgcatcggcctgaacctcttcaacaagaagcctgag
aagggagtccagtacctcatcgagcgtggcttcgtacctgacacgccagtgggagtggcc
cacttcttgctgcagcgcaagggcctgagcaggcagatgatcggcgagttcctgggcaac
cggcagaagcagttcaaccgcgatgtgcttgactgtgtggtggacgaaatggacttctct
gccatggagctggatgaggccctccggaagttccaggcgcacatccgtgtccagggcgag
gctcagaaagtggagcggctcattgaggccttcagccagcggtactgcatttgcaacccg
ggggtggtgcggcagttccggaacccagacaccattttcatcctggccttcgccatcatc
ctgctcaacacagacatgtacagccccaacgtcaagccggagcggaagatgaagctggag
gacttcgtcaagaacctccgaggtgtggatgatggtgaggacattccccgggagatgctg
attgggatctacgaacggattcgtaagcgagagctgaagaccaacgaggaccacgtgtcc
caggtgcagaaggtggagaagctcattgtggggaagaagccgatcggatccctgcatcac
gggctcggctgtgtgctctccctgccccaccgtcggctggtctgctactgccggctcttc
gaggttcctgacccaaacaagccccagaaacttgggctgcaccagcgagagatcttcctg
tttaatgacctcttggtggtcaccaagatcttccagaagaagaagaactcggtgacatac
agcttccggcagtccttctccctgtacggcatgcaggtcctgctcttcgagaaccagtac
taccccaatggcatccggcttacgtcagctgtccctggagcagacatcaaagtgttgata
aacttcaacgctcccaatcctcaagacaggaagaagttcactgatgacctgcgggagtcc
atcgcagaagtacaggagatggagaagcacaggatagaatcggagctcgagaagcagaag
ggcgtcgtacggcccagcatgtcccagtgctccagcctcaagaaggagtccggcaacggg
acgctgggccgggcctgcctggacgacagctacaccagcggcgagggcctcaagcgcagc
gccctcagcagctccctgagggacctctccgaagcggggaagcgagggcgtcgcagcagt
gcgggatcgctagagagcaatgtggaatttcagcctttcgagcctctgcagccaccagtg
ctgtgctcctaa

KEGG   Oryctolagus cuniculus (rabbit): 100355765
Entry
100355765         CDS       T03373                                 
Symbol
PSD4
Name
(RefSeq) pleckstrin and Sec7 domain containing 4
  KO
K12494  PH and SEC7 domain-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100355765 (PSD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100355765 (PSD4)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100355765 (PSD4)
SSDB
Motif
Pfam: Sec7 PH_9 PH
Other DBs
NCBI-GeneID: 100355765
NCBI-ProteinID: XP_008252353
Ensembl: ENSOCUG00000004174
UniProt: G1SL87
LinkDB
Position
2:97897328..97933556
AA seq 999 aa
MGDHRLPDHAQPVELLDIYLGGDLQPPPGHCPLGPPRPPEDQTWAVDPAGATRHDAPPWS
SDVEPSLLESCSSQGEPRQNTTASPGPPGDSRGLGSPQQNRNSSTQVVFWAGILQAQMCV
LDLEEELEKTEGLRAGLKCCLPPAPAELPGHPGLHPSSPVGEDSGEDSSGPEEEEKQAWP
REGTPGLSPEWGAEEESVFFDNPLFLESPGSEASASAERFSWGFPDPTTDVNLGPDGPQA
LEPPLLGGAVAWELGSEPEWGDHGAERSGRNTPPFPVPTYKLHPCCTFEPSTEGALAAPS
GQEESQTSLEDGLGPASPTAPKVDETLTWEPECLSSNLASASHPVQPWAPPSPEGWRMEE
GPSWRQVPVSQERGEREVGRPQPPAPCTVSPGAWESPACLPEPSCPESESTGPGPSLAAS
QEGGPQLQCHSSGALPNCMPNASHSLLLDTDGTEPSSLKEVEAGEAADPEEAVRSEDMVS
TAEAGGGPPSMPLTSAERLPESPMPQAETPEEGQRPLAGDKLANGVRTDKVAWNLASRLY
HLEGFRKSEVAAYLQKNNDFSKAVAEAYLTFFQFGGQSLDHALRGFLQALVLSGETQERE
RVLYQFSKRFHHCNPGLFPSADSVHTLTCAVMLLNTDLHGQNIGKSMSCQEFITNLRGLQ
DGGNFSKELLKALYWSIRSEKLEWAVDEEDTARPEKAQPSPPAGKMSSPLLQLAQDPAAP
TYKQGILARKMHQDADGKKTPWGKRGWKMFHTLLRGMVLYFLKGDSHGLEGQSLLGQMVD
EPVGVHHSLATPATHYTKRPHVFQLRTADCRLYLFQAPTAKEMSSWIARINLAAATHSAP
PFPAAVGSQRRFVRPILPMGPAQSSLEEQHRSHENCLDAASDDLLDLQRKLPERRGRGRE
LEEHRLRKEYLEYEKTRYETYVQLLVARLHCPEGDLALWEEQLGREAAGAREPKPSLKKS
HSSPSLHQEEAPTTAKVKRNISERRTYRKIIPKRNRNQL
NT seq 3000 nt   +upstreamnt  +downstreamnt
atgggcgaccacagactcccggaccacgcccaacccgtggaacttctcgacatctatttg
ggaggtgacctgcagccccctccaggacactgccctctgggccctcccagaccgcccgag
gaccagacctgggccgtggaccccgctggagccacccggcacgatgctcctccctggagc
tccgatgtggagccttcactcctggagagctgctcctcccagggggagcccaggcagaac
accacagcatccccggggccgcctggggacagccgtggtctggggagccctcagcagaac
cggaactcgtccacccaagtggtgttctgggcgggcatcctgcaggcccagatgtgtgtc
ctggacctggaggaggagctggagaagacggaagggctccgggctgggctgaagtgctgc
ctgccccctgcccctgcagagctgcccggccacccgggcctgcaccccagctcccccgtg
ggggaggactccggggaagacagcagcgggccggaggaggaggagaagcaggcatggccg
agggaggggaccccaggcctttcgcccgagtggggagcggaggaagagagcgtgttcttc
gacaacccgctcttcctggaaagccctggttctgaagccagtgcttctgcagagcgcttc
tcctgggggttcccagaccccaccacggatgtgaacttggggcccgatggcccacaggcc
cttgagccgccactgctagggggcgcagtggcttgggagctggggagtgagccagagtgg
ggggatcacggtgctgaacgcagtgggcgcaacacccctccgttcccggtgcccacctac
aagctgcacccctgctgcaccttcgagcccagcaccgagggggcccttgcagcaccttct
ggccaggaggagagccagacttcgctggaggacgggctgggccctgcctcccccacagca
cccaaagtggacgagacgttgacctgggaaccagaatgcctcagctccaacctcgcctct
gcctcacatcctgtgcaaccttgggccccacccagccccgagggctggcggatggaagag
ggtccctcctggcggcaggtgcctgtctcccaggagagaggtgagagggaggttgggcgg
ccccagcctcctgctccctgcaccgtgtcccccggcgcctgggagagcccagcctgtttg
ccagagcccagctgccccgagtctgagagcacaggccccgggcccagcctggcggcctcc
caggaaggtggcccacagctccagtgccacagctcaggcgctttgcccaactgcatgccg
aatgcctcacactctttgctcttggacacggacgggacagagccgagctccctgaaggaa
gtggaggcaggagaggccgctgacccagaggaggcagtgaggagtgaagacatggttagc
actgcagaggctggaggcggcccgcccagcatgcccttgacctctgccgaaaggcttccc
gagagccctatgccccaagcagagaccccagaggaaggccagaggccactggctggagac
aaactggctaatggtgtcaggacggacaaagtggcctggaacttggcctctcgcctctac
cacctggagggcttccggaagtctgaagtggctgcctacctgcagaagaacaatgacttc
agcaaggccgtggctgaggcgtacttgaccttcttccagtttggaggccagagcctggac
catgccctccggggcttcctccaggccctggtgctcagcggggagacccaggagcgggag
cgagtcctctaccagttctccaaacgcttccatcactgcaatcctgggctcttcccctca
gcagattctgttcacaccctgacctgtgcagtcatgctccttaacacggacctgcacgga
cagaacattgggaagagcatgagctgccaggaattcataaccaacctgcgtggcctgcag
gacggcgggaatttctccaaggagctactgaaggccctctactggtctatccgaagtgag
aagcttgagtgggccgtggatgaagaagacacagccaggcccgagaaggcccagccgtct
cccccggctggcaagatgagcagccccttgctccagctggcccaggaccccgcagcgccc
acctacaagcagggaatcctggctcgcaagatgcatcaggacgccgacggcaagaagaca
ccgtggggcaagcgtggctggaagatgttccacacgttactgcgagggatggttctctac
ttcctgaagggagacagccacggcctggaggggcagagcctgctggggcagatggtggat
gagcccgtgggggtgcaccactcgctggccaccccggccacccactacaccaagaggcca
cacgtcttccagctgcggacagcagactgtcgtctctacctcttccaggcccccacggcc
aaggagatgagctcctggatcgcgcgcatcaacctggccgccgccacgcactcggcgccc
cccttccccgccgccgtgggctcccagcgccgcttcgtgcggcccatcctgcccatgggc
ccagcccagagctccttggaggagcagcatcgatcccatgagaattgcctggacgctgcc
tccgacgacctgctggacctgcagcggaagctgcccgagcggcggggccgcggccgggag
ctggaggagcaccgcttgcgaaaggagtacctggagtacgagaaaacccgctacgagacc
tacgtgcagctgctggtggcccggctgcactgcccggagggtgacctggccctgtgggag
gagcagctggggagagaagctgcaggcgcacgggaacccaagcccagcctgaagaagtcc
cactccagcccgtccctgcaccaggaggaggcccccaccacggccaaggtgaagcgcaac
atctcggagcgcagaacctaccggaagatcatccccaagcggaaccgcaaccagctgtga

KEGG   Oryctolagus cuniculus (rabbit): 100356943
Entry
100356943         CDS       T03373                                 
Symbol
CYTH4
Name
(RefSeq) cytohesin 4
  KO
K18441  cytohesin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100356943 (CYTH4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100356943 (CYTH4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100356943 (CYTH4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100356943 (CYTH4)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100356943 (CYTH4)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    100356943 (CYTH4)
SSDB
Motif
Pfam: Sec7 PH PH_11 PH_20 PH_3 PH_6 PH_8
Other DBs
NCBI-GeneID: 100356943
NCBI-ProteinID: XP_008250248
Ensembl: ENSOCUG00000025413
LinkDB
Position
Un
AA seq 394 aa
MDLCHPDPAELSSGDLEELQRIRWHREQLLEDIQKLKDEIEEVFAQIDCFESAQESRLAQ
KERELSIGRKKFNMDPVKGIQYLTEHKLLTPDAQDIAQFLFKGEGLNKTAIGTYLGERDP
LNLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAARYCLCNPGVFQ
STDTCYVLSFSVIMLNTSLANPNVRDRPPFERFVAMNRGINGGSDLPEEQLRNLFDSIKS
EPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDSCLYYFEFTTDKEPR
GIIPLENLSVQPVDDPKKPFCLELYNPSCRGQKIKACKTDGDGKVVEGKHQSYRISASSA
EERDQWIQAIQASITRVPFYDLVSARRKKIVSKQ
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggatctgtgccacccagacccagcggagctgagcagcggcgacttggaggagctgcag
cgcatcagatggcaccgcgagcagctgctggaggacatccagaagctgaaagacgagatc
gaagaagtgttcgcccagatcgactgcttcgagagtgcgcaggagagccgcctggcgcag
aaagagagggagctgagcatcgggcgtaagaagttcaacatggacccggtgaagggcatc
cagtatctcacggagcacaagctgctgaccccggatgctcaggacatcgcccagttcctg
ttcaagggggagggcctcaacaagacggccatcgggacctacctgggggagagggaccct
ctcaacctgcaggtgctccaggccttcgtagactgccatgagttcgccaacctcaacctc
gtccaggccctcaggcagttcctatggagcttccgcctgcccggcgaggcccagaagatc
gaccgcatgatggaggccttcgcagcccgctactgcctctgcaacccgggcgtcttccag
tccacagacacctgctacgtgctgtccttctccgtcatcatgctcaacaccagccttgct
aaccccaacgtccgcgacaggccgcccttcgagcgcttcgtggccatgaaccgcggcatc
aacgggggcagcgacctccccgaggagcagctccggaacctctttgacagcatcaagagc
gagcccttctccatccccgaggacgacggcaacgacctcacgcacaccttcttcaacccg
gaccgcgagggctggctgctcaaactaggggggcgtgtgaagacctggaagcggcgctgg
ttcatcctgaccgacagctgcctctactatttcgagttcaccacggacaaggagccgcgg
ggaatcatccccctggagaacctctcagtgcagcccgtggacgaccccaagaagccattc
tgcctggagctctacaaccccagctgccggggccagaaaatcaaagcttgcaagacggat
ggggacggcaaggtggtggagggcaagcaccagtcctaccggatctcggcctccagcgcc
gaggagcgcgaccagtggatccaggccatccaggccagcatcacccgcgtccccttctac
gacctggtctctgctcggaggaagaagatcgtcagcaagcagtga

KEGG   Oryctolagus cuniculus (rabbit): 103346134
Entry
103346134         CDS       T03373                                 
Symbol
CYTH3
Name
(RefSeq) cytohesin 3
  KO
K18441  cytohesin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    103346134 (CYTH3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103346134 (CYTH3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103346134 (CYTH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103346134 (CYTH3)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    103346134 (CYTH3)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    103346134 (CYTH3)
SSDB
Motif
Pfam: Sec7 PH PH_11 PH_20 PH_3 PH_8 SASRP1
Other DBs
NCBI-GeneID: 103346134
NCBI-ProteinID: XP_008249915
LinkDB
Position
Un
AA seq 404 aa
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDSLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLVENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTT
DKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHMVYRI
SAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggacgaggacggcggtggcgagggcggcggcgttcctgaagacctttcattagaagaa
agggaagagcttttggacattcgtcgaagaaaaaaggaacttattgatgacattgagagg
ctgaagtacgaaatcgccgaggtgatgaccgagatcgacagcctgacgtctgtggaggag
agcaaaaccactcaaaggaacaagcaaatcgctatggggagaaagaagttcaacatggat
cccaaaaagggcattcagtttctggtggagaatgacctgctgcagagttccccggaggac
gtggcccagttcctgtacaaaggagaaggcctgaataagacggtcatcggggactacctg
ggggaaagggacgagtttaacatcaaggttcttcaggcttttgtcgaactgcacgagttt
gccgacctcaacctcgtacaagcattaagacagttcttgtggagcttccgactgcccggg
gaggcgcagaaaatcgaccgtatgatggaggccttcgcctcgcgctactgcctgtgcaac
cccggcgtcttccagtccacagacacgtgctacgtgctgtcgtttgccatcatcatgctc
aacaccagcctgcacaaccacaatgtgcgcgacaagcccacggccgagcgcttcatcacc
atgaaccgcggcatcaacgagggcggcgacctgcccgaggagctgctgcggaacttgtac
gagagcattaagaacgagccattcaagatccccgaggacgacgggaatgacctgacgcac
acgttcttcaaccccgaccgggagggctggctcctgaagctgggcgggcgtgtgaagacc
tggaagcggcgctggttcatcctcacggacaactgcctgtactacttcgagtacaccacg
gacaaggagcccaggggcatcatcccgctggagaacctcagcatcagggaggtggaagac
ccgcggaagcccaactgttttgagctttacaacccgagccacaagggccaagtcatcaag
gcctgcaagacggaggcggacggccgcgtggtggagggcaaccacatggtgtaccgcatc
tcggcgcccacccaggaggagaaggacgagtggatcaagtccatccaggcggcagtgagc
gtggaccccttctacgagatgctggcggcgaggaagaagcggatatctgtcaagaagaag
caggagcagccctga

KEGG   Oryctolagus cuniculus (rabbit): 103352390
Entry
103352390         CDS       T03373                                 
Symbol
ARFGEF2
Name
(RefSeq) ADP ribosylation factor guanine nucleotide exchange factor 2
  KO
K18442  brefeldin A-inhibited guanine nucleotide-exchange protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103352390 (ARFGEF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103352390 (ARFGEF2)
Membrane trafficking [BR:ocu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    103352390 (ARFGEF2)
SSDB
Motif
Pfam: Sec7 BIG2_C Sec7_N DCB DUF1981
Other DBs
NCBI-GeneID: 103352390
NCBI-ProteinID: XP_017206235
Ensembl: ENSOCUG00000005446
LinkDB
Position
Un
AA seq 1786 aa
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGAAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPIQSKPQSPVIQAAAGSPKFSRWKQNQAQS
KPTTPERADLTNGEHARGGPGRVSSENGDAPRDRGSSLSGTDSGAQEVVKDILEDVVASA
VKEASEKRGVTEHERSLGELECQDSAGPPGADEDSQTNGIADDRQSLSSADNLESDVQGH
QVAARFSHILQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLLSVLQNAGP
VFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQIEVFFKE
IFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKI
AQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLGQERLPDQD
MGDGKGLDLARRSSVTSMESTVSSGTQTAVQDDPEQFEVIKQQKEIIEHGIELFNKKPKR
GIQFLQEQGMLGTSADDIAQFLHQEERLDSTQVGDFLGESTRFNKEVMYAYVDQLDFCEK
EFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIMLT
TDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETKEHTIASK
STKQSVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTP
LLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTASSSI
TEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRYLSGSGRE
REGSLKGHTLAGEEFMGLGLGNLVSGGVDKRQMASFQESVGETSSQSVVVAVDRIFTGST
RLDGNAXVLDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWHVVG
DHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTI
RDMVIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVTNIFQHH
FPAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTSDDMNVA
PGDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFRIVF
RIFDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFAQLQWCVKQD
NEQLARSGTNCLENLVISNGEKFSPAVWDETCSCMLDIFQTTIPHVLLTWRPAGMEDDSS
ERHWDVDLDHQSVSSVDKNASERGQSQLSNPTDDSWKGRPYANQKLFASLLIKCVVQLEL
IQTIDNIVFYPATSKKEDAEHMVAAQQDTLDADIHIETEDQGMYKYMSSQHLFKLLDCLQ
ESHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDENRRDSW
EEIQQRLLTVCGDALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHASRYYPYL
CEIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPPRVPATLSPAW
NT seq 5361 nt   +upstreamnt  +downstreamnt
atgcaggagagccagaccaagagcatgttcgtgtcccgggccctggagaagatcctagcc
gacaaggaggtgaagcggccccagcactcccagctgcgcagggcctgccaggtggcgctc
gatgaaattaaagcggaaatagagaagcagaggctcggcgctgctgcaccaccaaaggct
aacttcattgaagctgacaagtatttccttccgttcgagctggcttgccagtccaagtcc
ccccgggtggtcagcacatccctcgactgcttgcagaaactcatcgcatatgggcacatc
accggcaatgcccccgacagcggagccccagggaagcggctgatcgacaggatcgttgaa
accatttgcaattgtttccagggccctcagactgacgaaggggttcagttacaaataatt
aaggcccttctgacggcagtgacttccccacacatcgaaattcatgagggcaccatcctg
caaacggtgcggacgtgctacaatatctatctggccagcaaaaatctcatcaatcaaacc
accgccaaggccacccttacccagatgctgaacgtcatcttcacccgcatggaaaaccaa
gtgttgcaggaggctagagaattggaaaaaccgatccagtcgaaaccccagtcccccgtg
atccaggctgcagcagggtccccaaagttcagtcgttggaagcagaatcaggcacaaagc
aaaccgactactcctgaaagagcagacttaaccaacggtgaacacgccaggggcggtcct
gggagagtgagctcggaaaacggagacgcacccagagacagaggctcgtcactctcaggg
actgacagcggagcccaggaggtggtgaaagacatcttagaagacgtggtcgcctcagct
gtcaaagaagcatcagaaaagcgcggtgtgacagaacacgagaggagcttgggcgaactg
gagtgccaggacagtgccggtccccctggagctgatgaggactcacagaccaacggcata
gcagatgacaggcagtccttgtcctcggcagacaacctggaatcggacgtgcaaggacat
caggtggctgccaggttctcgcacattctgcagaaggatgccttcctcgtgttccgctcc
ctgtgcaaactgtccatgaagcccctcggggaaggccccccagaccccaagtcccatgag
ctgcgctccaaggtggtctcactgcagctgctgctctctgtgttgcaaaatgccggcccc
gtcttcaggactcacgagatgttcatcaatgcgatcaagcaatatctctgcgtggccttg
tccaaaaatggcgtctcttcagtgcctgatgtcttcgagctctctcttgccatttttctt
actcttctttcaaactttaaaatgcacttgaaaatgcagatagaggtcttcttcaaagag
attttcctgaacattttagaaacatcgacgagttctttcgagcacaggtggatggtcatt
cagactctgacgaggatctgtgcagatgcccagtgtgttgtggatatttatgtcaactat
gactgcgatttaaatgctgctaacattttcgagcgtcttgtaaatgatttgtccaaaatc
gctcagggaagaagtggccatgagctgggaatgacaccactacaggagctcagtctgagg
aagaaaggcctggagtgcctcgtgtccatcctcaagtgcatggtggagtggagcaaagac
ctgtatgtgaatcccaaccaccagaccagcctgggccaggagagactcccggatcaggat
atgggggacgggaaaggcctggacttggccagacggagcagcgtgacatccatggagtcc
acagtctcctctgggacccagacagccgttcaggatgacccggagcagtttgaggtcatc
aagcagcaaaaggaaatcatcgaacacggcatcgagctattcaacaagaaacctaagagg
ggaatccagtttctccaggagcagggcatgctgggaacatccgctgatgacattgcccag
ttcctacaccaggaggagcgccttgattctacccaggtgggtgattttctgggagaaagc
acaaggttcaacaaggaagtgatgtatgcctacgtggaccagctcgacttctgcgagaag
gaatttgtctcagctctgcggacgttcctggaaggtttccgtctgcctggggaagcccag
aagattgaccggttgatggagaagtttgccgcaagatacatagagtgcaaccaagggcag
acgctctttgccagtgccgacactgcctatgtgctagcatattccattattatgctgacg
acagacttgcacagtcctcaggtaaaaaacaaaatgacaaaagagcaatatattaagatg
aatcgaggtatcaatgacagtaaagatctaccggaagaatatctctccagcatctatgaa
gagatagaaggcaagaaaatcgcaatgaaagaaacaaaggagcacacaattgcatccaaa
tctactaagcagagtgtagctagtgaaaagcagcgacggctgctgtacaacctggagatg
gagcaaatggctaaaacggccaaggcgctgatggaggctgtgagccacgccaaagcccca
tttacaagtgccactcatctggaccacgtccggccgatgttcaagctggtgtggacccca
ctgttggcggcctacagcattggactgcagaactgtgacgacacggaagtggcctcgctg
tgcctggagggcatccgatgtgcaatcagaattgcctgcatcttcggaatgcagctggaa
cgggatgcctacgttcaggctcttgcacgcttctccctgctgacggccagctccagcatc
accgagatgaagcagaagaacatcgacaccataaagacgctcatcacagtagctcacact
gacggcaactacctgggcaattcctggcacgagatcctgaaatgcatcagccagctcgag
ctcgctcagctgataggaaccggcgtgaagactcgctacctgtccgggtccggccgagag
agagaagggagcctgaagggccacacgctggcgggagaagagttcatgggccttggcctg
ggtaacttggtgagtggtggcgtggataaaagacagatggccagcttccaggaatcggtc
ggggagaccagctctcagagtgtggttgtagctgtggacagaatctttacgggctctacc
agactggatgggaatgcataggtacttgactttgtccgctggctgtgtgctgtgtccatg
gatgaactggcttccccccaccaccctcgcatgttcagcttgcagaagatcgtggagatc
tcgtactacaacatgaaccgcatccggctgcagtggtcccgcatatggcacgtggtcgga
gatcacttcaataaggttggctgtaaccccaatgaagatgtggctatttttgctgtggac
tcgttaaggcagctctccatgaagttccttgaaaagggcgaattagccaacttccgtttc
cagaaagacttcctgaggccctttgagcacatcatgaagaagaacaggtccccgaccatc
cgggacatggtgatccgctgcatcgcccagatggtgaactcgcaggctgccaacatccgc
tctggctggaaaaacatcttcgccgtgttccaccaggcagcctccgatcacgacgggaac
atcgtggagctggccttccagaccacgggccacatcgtcacaaacatcttccagcaccac
ttccctgcagccatcgactccttccaggacgctgtgaagtgcttgtcggagtttgcctgc
aacgctgctttccccgacaccagcatggaagccatccggctcatccgcttctgtggcaaa
tacgtctccgagaggcctcgggtgctacaagaatacacgagtgacgacatgaacgtggcc
cctggcgaccgagtctgggttcgaggctggttccccatcttgtttgagctctcctgcatc
attaataggtgcaagctggatgtgcggacaaggggactcacggtcatgttcgagatcatg
aagagctacggccacacgtttgagaagcactggtggcaggacctgttcagaatcgtgttt
cggatttttgacaacatgaaactccctgagcagcagtcggagaaatctgagtggatgaca
acaacctgcaatcacgcactttatgctatttgtgacgtctttacgcagttttatgaagct
ttgaatgaagtccttctttctgatgtctttgcacaattgcagtggtgtgtaaagcaagat
aatgaacagttggctcggtctggtacaaattgcttagaaaacttggtgatctccaacgga
gagaagttcagccccgccgtgtgggatgagacctgcagctgcatgctggacatcttccag
acaaccatcccacacgttttgctgacctggaggcctgcgggaatggaggacgactcatca
gagagacactgggatgtggatctggaccaccagtctgtaagcagtgtagacaaaaatgcc
tccgagagaggccagagccagctctccaaccccaccgacgacagctggaagggtagacca
tatgcaaatcagaagctgtttgccagcctcctcatcaagtgtgtggtccagctggagctg
atccagaccatcgacaacatcgtgttctaccctgccacgagcaaaaaggaagacgccgag
cacatggttgctgcccagcaagacacgctggacgctgacatccacatagagacggaggac
cagggcatgtacaagtacatgtcctcccagcacctcttcaagctgctggactgcttgcag
gagtcccattccttctcgaaggctttcaactccaattacgagcagcggaccgtcctgtgg
cgagcaggttttaagggcaagtctaaacccaatcttctaaaacaagaaaccagcagcctg
gcctgttgtttgaggatcctgtttcggatgtatgtggatgagaaccgccgggattcctgg
gaagaaatacagcaacgacttctaacggtgtgcggtgatgctctcgcctatttcatcacc
gtgaattctgaaagtcatcgggaggcctggacaagtctcctgttgctgcttctaaccaaa
accctcaagataaatgacgaaaagttcaaagcacacgcttcgaggtactatccctacttg
tgtgaaattatgcagtttgacctgatccccgagctgcgagcagtgctgcggaagttcttc
ctacggataggtgttgtgtataagatatggattccagaagagccaccacgggtgccagcc
acactgtccccagcgtggtag

DBGET integrated database retrieval system