KEGG   Oryctolagus cuniculus (rabbit): 100340235
Entry
100340235         CDS       T03373                                 
Symbol
TNFRSF19
Name
(RefSeq) TNF receptor superfamily member 19
  KO
K05155  tumor necrosis factor receptor superfamily member 19
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100340235 (TNFRSF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100340235 (TNFRSF19)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100340235 (TNFRSF19)
SSDB
Motif
Pfam: TNFR_c6 Ephrin_rec_like
Other DBs
NCBI-GeneID: 100340235
NCBI-ProteinID: XP_008258126
Ensembl: ENSOCUG00000011779
UniProt: A0A5F9D4H6
LinkDB
Position
8:complement(41080132..41185183)
AA seq 417 aa
MALKILPEQEKTFFTIVVLLGCLLCTAICETGDCRQQEFRDRSGNCVLCKPCGPGMELSK
ECGFGYGEDAHCVTCRPHRFKEDWGFQKCKPCLDCALANRFQKANCSVTSDAVCGDCLPG
FYRKTKLVGFQDMECVPCGDPPPPYEPHCTSKVNLVKIASTASSPRDTALAAVICSALAT
VLLALLILCVIYCKRQFMEKKPSWSLRSQDVQYNGSELSCFDRPRLSPCAHRACCQCHRG
SAQPYGPLHLIPSLCCDEACGANRAALACGAHSAATLQERNAGAAGDTMAAFFGSSSRSV
CGEFSDAWPLMQDATGGDSISFCDSYSELAGEDLHSLNPENESATSLDPDSGQDLVGGAA
PTESHSENSTENTDSPKYRSARAEPAAAQDALCAGSQLEQESSRTGNATTAPALQEA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggctttaaaaatactaccagagcaagagaaaacatttttcaccattgtagttttatta
ggctgtctgctatgtacagcaatctgtgaaacaggagactgtagacaacaggaattcagg
gatcggtctggaaactgtgtcctctgcaagccgtgtgggcctggcatggagttgtctaag
gaatgtggcttcggctacggggaggatgcacactgtgtgacatgccggccgcacaggttc
aaggaggactggggcttccagaaatgcaagccgtgtctggactgtgcgcttgcaaaccgc
tttcagaaggcaaattgctccgtcaccagtgacgccgtgtgtggggactgcttgccgggg
ttttataggaagacgaagctggttggatttcaggacatggagtgcgtgccttgtggggac
cccccgcctccttatgaaccacactgtaccagcaaggtcaacctggtgaagatcgcatcc
acggcctccagtcctcgggacacggccctggctgcggtcatctgcagcgccctggccacc
gtcctcctggcactcctcatcctctgtgtcatctattgcaagagacagttcatggagaaa
aaacccagctggtctctgaggtcccaagacgtgcagtacaacggctctgagctgtcctgt
tttgacagacctcggctcagcccgtgtgctcacagagcctgctgtcagtgccaccggggc
tccgcccagccttacgggcctcttcacctgatcccgtccctgtgctgcgacgaggcttgc
ggtgccaaccgggcagctctagcttgtggggcgcattctgcagccaccctacaggagagg
aacgcaggggcagctggggataccatggcagccttcttcgggtcctcttcgcggtccgtc
tgtggcgagttctcggacgcctggcctctgatgcaggatgccactggtggtgacagcatc
tccttctgtgactcttactctgaactcgctggagaggatcttcattccctcaatccagaa
aacgaaagcgcaacatctttggatccagacagtggtcaggatttggtgggcggagcagct
cccactgaaagtcattctgaaaactctacagaaaacacggactcccccaaatacaggagc
gcgcgggcagagccagcagcagctcaggatgcactgtgtgctggaagccagctggagcaa
gagagcagccgcactgggaatgcaaccactgccccggccctccaggaagcttag

DBGET integrated database retrieval system