KEGG   Oryctolagus cuniculus (rabbit): 100340347
Entry
100340347         CDS       T03373                                 
Symbol
VPS36
Name
(RefSeq) vacuolar protein sorting 36 homolog
  KO
K12190  ESCRT-II complex subunit VPS36
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100340347 (VPS36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100340347 (VPS36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100340347 (VPS36)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-II complex
    100340347 (VPS36)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100340347 (VPS36)
  Exosomal proteins of colorectal cancer cells
   100340347 (VPS36)
SSDB
Motif
Pfam: EAP30 Vps36_ESCRT-II MA3 GRAM Xre-like-HTH
Other DBs
NCBI-GeneID: 100340347
NCBI-ProteinID: XP_002720787
Ensembl: ENSOCUG00000015505
UniProt: G1T9L2
LinkDB
Position
Un
AA seq 386 aa
MDRFVWTSGLLELNETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMA
VPLSQIVFVEEQAAGIGKSAKIVVHLHPAPSNKEPGPFQSSKNSYIKLSFKEHGQIEFHR
RLSEEMIQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFED
LSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQ
YHMQLAKQLAGILQAPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLESLKLP
VRLRVFDSGVMVIELQSHKEEEMVASALETVSERGSLTSEEFAKLVGMSVLLAKERLLLA
EKMGHLCRDDSVEGLRFYPNLFMTQS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaccgcttcgtgtggaccagcggcctcctggagctcaacgagaccctggtgatccag
cagcgcggggtgcgcatctacgacggcgaggagaagataaaatttgatgctgggaccctc
cttcttagtacacaccgactgatttggagagatcagaaaaatcatgagtgctgcatggcc
gttcctctttcccaaattgtgttcgttgaggaacaggcagctggaattgggaagagtgcc
aagatagtggttcatcttcatccagctccttctaacaaagagcctggcccattccagagc
agtaagaactcctacatcaaactctctttcaaggagcatggccagattgagtttcacagg
cgtttatcagaggagatgatacagagaagatgggagaatatgccagtttcccagtcatta
caaacaaatagaggaccccagccaggaagaataagggctgtaggaattgtaggtattgaa
aggaaactggaagaaaaaagaaaagaaacggacaaaaacatttctgaggcttttgaagac
ctcagcaagctgatgatcaaggctaaagaaatggtggagttatcaaaatcaattgctaat
aaaattaaagacaaacaaggtgatatcacagaagatgagaccatcaggtttaaatcctac
ttgctgagcatgggaatagccaacccggttaccagggaaacctatggctctggcacacag
taccacatgcagctggctaaacagctggctggaatattacaggcgcctttagaggaacga
ggaggaataatgtcactcacagaggtgtactgtttagtaaaccgggctcgaggaatggaa
ttgttgtcaccggaagatttagtgaatgcctgcaagatgctggaatcgctgaagttaccc
gtcaggctccgagtttttgacagtggcgtcatggtaattgagcttcagtcccacaaagaa
gaggaaatggtggcctcagccctggagacagtttcagaaaggggatccctaacatccgaa
gaatttgctaagctcgtgggaatgtctgtcctcctggccaaggaaaggttgcttcttgca
gagaagatgggccatctttgccgagatgactcagtggaaggcttgcgattttacccaaat
ttatttatgacacagagctaa

DBGET integrated database retrieval system