Oryctolagus cuniculus (rabbit): 100340438 Help Entry 100340438         CDS       T03373                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04613   Neutrophil extracellular trap formation ocu05034   Alcoholism ocu05203   Viral carcinogenesis ocu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ocu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100340438  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100340438   09163 Immune disease    05322 Systemic lupus erythematosus     100340438   09165 Substance dependence    05034 Alcoholism     100340438  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100340438 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100340438 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  100340438 NCBI-ProteinID:  XP_002720058 Ensembl:  ENSOCUG00000024696 UniProt:  G1TFJ3 LinkDB All DBs Position X:complement(22641947..22645001) Genome browser AA seq 103 aa AA seqDB search MSGRSKGGKGLGKGGAKRHCKVLRDNIQGITKPAICHLARRGGIKCISGIIYKETHGVLK VFLENVIHDAVTYTEHAKCKTVMAMDMVYTLKCQGRTLYGFSS NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcagcaagggtgggaagggcctaggcaagggcggtgccaagcgccactgc aaggtgctgcgagacaacatccagggcatcaccaagcccgccatctgccacctggcccgg cgtggcggcatcaagtgcatctcagggatcatctacaaggagacccacggcgtgctcaag gtcttcttggagaatgtcatccacgatgcagtcacctacacggagcatgccaagtgcaag acggtcatggccatggatatggtctacacgctcaagtgccagggccgcacgctctacggc ttcagcagctga

DBGET integrated database retrieval system