KEGG   Oryctolagus cuniculus (rabbit): 100340593
Entry
100340593         CDS       T03373                                 
Symbol
CXCL11
Name
(RefSeq) C-X-C motif chemokine ligand 11
  KO
K12672  C-X-C motif chemokine 11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100340593 (CXCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100340593 (CXCL11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100340593 (CXCL11)
   04062 Chemokine signaling pathway
    100340593 (CXCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100340593 (CXCL11)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100340593 (CXCL11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100340593
NCBI-ProteinID: XP_002717052
Ensembl: ENSOCUG00000026515
LinkDB
Position
15:74344568..74346546
AA seq 99 aa
MSVKGVLLVLAVILCATTVQGFPMFKGGRCLCTGPGVKAVKVADVQKATIIYPSGSCDKT
EVIITLKAKKGQQCLNPRSKQASLIIKQIERKTLRNQNV
NT seq 300 nt   +upstreamnt  +downstreamnt
atgagtgtgaagggtgtgcttttagtcttggctgtgatactctgtgctacaactgttcaa
ggcttccccatgttcaaagggggacgctgtctttgcacaggccctggagtaaaagcagtc
aaagtggcagatgttcagaaagccaccataatttacccaagcggcagctgtgacaaaaca
gaagtaattatcaccctgaaagcaaaaaaaggacaacaatgcctgaatcccagatccaag
caagcaagtcttataatcaagcaaattgaaagaaagactttaagaaatcaaaatgtatga

DBGET integrated database retrieval system