KEGG   Oryctolagus cuniculus (rabbit): 100340653
Entry
100340653         CDS       T03373                                 

Symbol
TNFRSF17
Name
(RefSeq) TNF receptor superfamily member 17
  KO
K05153  tumor necrosis factor receptor superfamily member 17
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100340653 (TNFRSF17)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100340653 (TNFRSF17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100340653 (TNFRSF17)
   04090 CD molecules [BR:ocu04090]
    100340653 (TNFRSF17)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100340653 (TNFRSF17)
CD molecules [BR:ocu04090]
 Proteins
  100340653 (TNFRSF17)
SSDB
Motif
Pfam: BCMA-Tall_bind TACI-CRD2
Other DBs
NCBI-GeneID: 100340653
NCBI-ProteinID: XP_008255958
Ensembl: ENSOCUG00000001561
LinkDB
Position
6
AA seq 180 aa
MSQHCFQNEYFDNLLGTCKPCHLRCSKAPPVTCQRYCNASVASSVKGTNAILWTCLGLSV
TVSLAVFVLMVLLRKMSSEPLKDACKNTGSVLLDVANAGLGGSRTGDERTLPRGLGYTVE
ECTCEDCVKSKPKVDSDHFFPLPAMEEGATILVTTKTNDYSNSLPLASSTTGVEKSISTA
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtctcagcactgtttccagaatgagtactttgacaatctgctgggtacttgcaaacct
tgtcaccttcgctgttccaaggcccctcctgtaacatgtcagcgctactgtaatgccagt
gtggccagttcagtgaaaggaacaaacgcgattctgtggacatgcttgggcctgagtgtg
acagtttctttggcagtgtttgtactcatggtcctcctgaggaagatgagctcggagcca
ttaaaggatgcatgcaaaaacacaggatcggttctcctggacgtggctaatgctggcctg
ggcggcagcagaactggtgatgaaagaactctacccagaggccttgggtacacggtggaa
gagtgtacctgtgaagactgcgtcaagagcaaaccaaaggtcgattctgatcatttcttc
ccactcccagccatggaggagggcgcaaccattcttgttaccactaaaactaatgactat
tccaacagcctgccacttgcttcaagcactacaggggtagaaaagtcaatttctactgcg
tag

DBGET integrated database retrieval system