KEGG   Oryctolagus cuniculus (rabbit): 100340719
Entry
100340719         CDS       T03373                                 
Symbol
GNAQ
Name
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04929  GnRH secretion
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu05010  Alzheimer disease
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05143  African trypanosomiasis
ocu05146  Amoebiasis
ocu05163  Human cytomegalovirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100340719 (GNAQ)
   04371 Apelin signaling pathway
    100340719 (GNAQ)
   04020 Calcium signaling pathway
    100340719 (GNAQ)
   04071 Sphingolipid signaling pathway
    100340719 (GNAQ)
   04022 cGMP-PKG signaling pathway
    100340719 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100340719 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100340719 (GNAQ)
   04062 Chemokine signaling pathway
    100340719 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    100340719 (GNAQ)
   04922 Glucagon signaling pathway
    100340719 (GNAQ)
   04929 GnRH secretion
    100340719 (GNAQ)
   04912 GnRH signaling pathway
    100340719 (GNAQ)
   04915 Estrogen signaling pathway
    100340719 (GNAQ)
   04921 Oxytocin signaling pathway
    100340719 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    100340719 (GNAQ)
   04918 Thyroid hormone synthesis
    100340719 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    100340719 (GNAQ)
   04916 Melanogenesis
    100340719 (GNAQ)
   04924 Renin secretion
    100340719 (GNAQ)
   04925 Aldosterone synthesis and secretion
    100340719 (GNAQ)
   04927 Cortisol synthesis and secretion
    100340719 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100340719 (GNAQ)
   04270 Vascular smooth muscle contraction
    100340719 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    100340719 (GNAQ)
   04971 Gastric acid secretion
    100340719 (GNAQ)
   04972 Pancreatic secretion
    100340719 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100340719 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    100340719 (GNAQ)
   04725 Cholinergic synapse
    100340719 (GNAQ)
   04728 Dopaminergic synapse
    100340719 (GNAQ)
   04726 Serotonergic synapse
    100340719 (GNAQ)
   04720 Long-term potentiation
    100340719 (GNAQ)
   04730 Long-term depression
    100340719 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    100340719 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100340719 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100340719 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340719 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100340719 (GNAQ)
   05163 Human cytomegalovirus infection
    100340719 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100340719 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100340719 (GNAQ)
   05142 Chagas disease
    100340719 (GNAQ)
   05143 African trypanosomiasis
    100340719 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100340719 (GNAQ)
   05016 Huntington disease
    100340719 (GNAQ)
   05017 Spinocerebellar ataxia
    100340719 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    100340719 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100340719 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100340719 (GNAQ)
   04031 GTP-binding proteins [BR:ocu04031]
    100340719 (GNAQ)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100340719 (GNAQ)
GTP-binding proteins [BR:ocu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    100340719 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 100340719
NCBI-ProteinID: XP_008254913
Ensembl: ENSOCUG00000016559
LinkDB
Position
1:complement(64138436..64340461)
AA seq 301 aa
MRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKHEHNKAHAQLVREVDV
EKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQD
VLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQV
LVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGP
QRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL
V
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaggatcatccatgggtcgggctactctgatgaagacaaaaggggcttcaccaagctg
gtgtatcagaacatcttcacggccatgcaggccatgatcagagccatggacacgctcaag
atcccctacaagcatgagcacaataaggctcatgcacagttagttcgggaagttgatgtg
gagaaggtgtctgcttttgagaatccatacgtagatgcaataaagagtttatggaatgat
cctggaatccaggaatgctacgatagacgacgagagtatcagttatctgactccaccaaa
tactatctaaatgacttggaccgcgtagccgaccctgcctacctgcctacgcaacaagat
gtgcttagagttcgagtccccaccacagggatcatcgaatacccctttgacttacagagt
gtcattttcagaatggtcgatgtagggggtcaaaggtcagagagaagaaaatggatacac
tgctttgaaaacgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagtt
ctcgtggagtcagacaatgagaaccgaatggaagaaagcaaagcactctttagaacaatt
atcacatatccctggttccagaactcctcggttattctgttcttaaacaagaaagatctt
ctagaagagaaaatcatgtattcccaccttgttgactacttcccagagtacgacggaccg
cagagagatgcccaggcagctcgagaattcatcctgaagatgttcgtggatctgaatcca
gacagtgacaaaattatctactcccacttcacgtgcgccacagacaccgagaacatccgc
tttgtcttcgcggctgtcaaggacaccatcctccagttgaacctgaaggagtacaacctg
gtctga

DBGET integrated database retrieval system