Oryctolagus cuniculus (rabbit): 100340735 Help Entry 100340735         CDS       T03373                                  Name (RefSeq) profilin-4   KO K05759   profilin Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04015   Rap1 signaling pathway ocu04810   Regulation of actin cytoskeleton ocu05014   Amyotrophic lateral sclerosis ocu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100340735  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100340735  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100340735   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100340735  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100340735   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ocu04812]     100340735    04147 Exosome [BR:ocu04147]     100340735 Membrane trafficking [BR:ocu04131]  Others   Actin-binding proteins    Others     100340735 Cytoskeleton proteins [BR:ocu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100340735 Exosome [BR:ocu04147]  Exosomal proteins   Proteins found in most exosomes    100340735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100340735 NCBI-ProteinID:  XP_002710109 LinkDB All DBs Position 2:complement(173488776..173500583) Genome browser AA seq 129 aa AA seqDB search MSHLQTLLLDTLLGTKHVDCAALIKIQERTLCVASPGFNVMPSDVRTLVNGFAKNPLQAR REGLYFKEKDYKCVRADENSLYAKNGNTGVIVVKTHLYLLVATYTESMYPSVCVEATEKL GEYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccacctgcagacgctgctgttagacaccctcctggggaccaagcacgtggactgt gccgcgctcatcaagatccaggagcggaccctgtgtgtggcatcgccgggattcaatgta atgccaagtgatgtccgaactcttgtgaatggattcgccaaaaaccccttgcaggcccga agagaagggctgtatttcaaggaaaaggactacaaatgtgtccgggcagatgaaaattct ctttacgctaagaatgggaacaccggcgtgattgttgtaaagactcatctgtatcttctg gtggcgacttacaccgagagcatgtaccctagtgtgtgtgtggaagccacagagaagctg ggagaatatctaaggaaaaaaggaaattaa

DBGET integrated database retrieval system