KEGG   Oryctolagus cuniculus (rabbit): 100340820
Entry
100340820         CDS       T03373                                 
Symbol
IL9
Name
(RefSeq) interleukin 9
  KO
K05432  interleukin 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu05310  Asthma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100340820 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100340820 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100340820 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100340820 (IL9)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100340820 (IL9)
SSDB
Other DBs
NCBI-GeneID: 100340820
NCBI-ProteinID: XP_002710151
UniProt: G1SQV6
LinkDB
Position
3:complement(18397243..18400570)
AA seq 143 aa
MLLAVVLVSSLLFCSVAAQGCLTRAGVRDVDFLIHSLQDDPLSKCDCSTNVTGCLCLPIP
SDNCTTPCFQEGLSQAANSKAHAKLSLIFNRVRRTVEALKSKCPLFSCEQPCNQTTAGTT
VTFLRTLLEVFQKEARPGMTART
NT seq 432 nt   +upstreamnt  +downstreamnt
atgcttctggccgtggtccttgtctcctccctcctgttctgctccgtagcagcccagggg
tgtctgacccgggcaggggtcagggatgtggacttcctcatccacagtctacaggatgat
ccgctttcaaaatgcgactgcagcaccaacgtgaccggttgcttgtgtctgcccatcccg
tctgacaactgcaccacgccgtgtttccaggaggggctatcccaggcggccaactccaag
gcacatgcaaaactctcgctgattttcaaccgcgtgagaagaacggtggaagccttgaag
agcaagtgtccgcttttctcctgtgagcagccctgcaaccaaaccacggcgggcaccacg
gtgacgttcctgaggacgctcctggaggtcttccagaaagaagcaaggccggggatgaca
gccaggacgtga

DBGET integrated database retrieval system