KEGG   Oryctolagus cuniculus (rabbit): 100340879
Entry
100340879         CDS       T03373                                 
Symbol
ELOB, TCEB2
Name
(RefSeq) elongin B
  KO
K03873  elongin-B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04066  HIF-1 signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100340879 (ELOB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100340879 (ELOB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340879 (ELOB)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100340879 (ELOB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100340879 (ELOB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100340879 (ELOB)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100340879 (ELOB)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul2 complex
    Adoptor protein
     100340879 (ELOB)
   Cul5 complex
     100340879 (ELOB)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100340879 (ELOB)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD
Other DBs
NCBI-GeneID: 100340879
NCBI-ProteinID: XP_008248834
Ensembl: ENSOCUG00000010116
UniProt: G1SYL8
LinkDB
Position
Un
AA seq 118 aa
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ
NT seq 357 nt   +upstreamnt  +downstreamnt
atggacgtgttcctcatgatccggcgtcacaaaaccaccatcttcacggacgccaaggag
tcgagcaccgtcttcgaactgaagcgcatcgtcgagggcatcctcaagcggccgcccgac
gagcagcggctgtacaaggacgaccagcttctggatgacggcaagaccctgggcgaatgc
ggcttcaccagtcagacggcacggccacaggctccagccacagtgggactggccttccgg
gcagatgacgctttcgaagctctgcgcatcgagcccttctccagccccccggagctgcct
gatgtcatgaagccccaggactcagggagcagcgccaacgaacaggctgtgcagtga

DBGET integrated database retrieval system