KEGG   Oryctolagus cuniculus (rabbit): 100340988
Entry
100340988         CDS       T03373                                 
Symbol
IL36RN
Name
(RefSeq) interleukin 36 receptor antagonist
  KO
K05483  interleukin 36 receptor antagonist protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100340988 (IL36RN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100340988 (IL36RN)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100340988 (IL36RN)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 100340988
NCBI-ProteinID: XP_002709656
Ensembl: ENSOCUG00000010998
UniProt: G1T0E8
LinkDB
Position
2:97808106..97813922
AA seq 155 aa
MVLSGALCFRMKDSALKVLYLHNDQLLAGGLHAGKVIKGEEISVVPNRSLDARLSPVILG
VQGGSRCLSCGMEQEPTLKLEPVNIMELYRDAQESKSFTFYRRDMGLTSSFESAAYPGWF
LCTVPEADQPVRLAQIPDNAGWDAPITDFYFQQCD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggtcctgagtggggcactgtgcttccgaatgaaggattcggccttgaaggtgctttat
ctgcataatgaccagcttctggctggagggctgcacgcagggaaggtcatcaaaggcgag
gagatcagtgttgtccccaaccggtcactggatgccaggctctcgccagtcatcctgggt
gtccaaggaggaagcaggtgcctgtcttgtgggatggagcaggagccaactctgaagtta
gagccagtgaatatcatggagctctaccgcgacgcccaggagtccaagagcttcaccttc
taccggcgggacatggggctcacctccagctttgagtcagctgcctacccaggctggttc
ctgtgcacagtgcctgaggctgaccagcctgtcaggctcgcccagatccccgataatgct
ggctgggatgcccccatcacggacttctacttccagcagtgtgactag

DBGET integrated database retrieval system