KEGG   Oryctolagus cuniculus (rabbit): 100340992
Entry
100340992         CDS       T03373                                 
Symbol
CSF1R
Name
(RefSeq) colony stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04151  PI3K-Akt signaling pathway
ocu04380  Osteoclast differentiation
ocu04640  Hematopoietic cell lineage
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100340992 (CSF1R)
   04014 Ras signaling pathway
    100340992 (CSF1R)
   04015 Rap1 signaling pathway
    100340992 (CSF1R)
   04151 PI3K-Akt signaling pathway
    100340992 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100340992 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100340992 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100340992 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100340992 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340992 (CSF1R)
   05202 Transcriptional misregulation in cancer
    100340992 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100340992 (CSF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100340992 (CSF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100340992 (CSF1R)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100340992 (CSF1R)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100340992 (CSF1R)
CD molecules [BR:ocu04090]
 Proteins
  100340992 (CSF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set
Other DBs
NCBI-GeneID: 100340992
NCBI-ProteinID: XP_017196678
LinkDB
Position
3:complement(31834455..31858288)
AA seq 805 aa
MASPSTRPKFLESRDYYCCALVDGKIMKSIGIELRVQQVLPGPPSLTLAPAELVRIQGET
ASIVCSASNLDYNFNVFLQRGDTKLALSEDSDFHDGSYHKVLTLSLSDVSFQDAGNYTCV
ATNPQGTRSSSMVFRVVGSAYVNLTSKQNLFQEVSVGETLNLQVQVEAYPDLQSFNWTYL
GPFSDYEPKLEFITNKDMYRYTSSLSLRRLKPTEAGRYCFLARNVGGSSALTFELALQYP
PAVTLTRTLVNGSDALFCDVSGYPQPNVTWLQCRGHADRCDEAHVLWIWEDPSPKVLSQE
PFHKVTVQSLLSTGSLEHNVTYECRALNTVGNDSETFRPVSIGAYVQLPEGSLFTPVVVA
CLSVMALLLLLLLLLLYKYKQKPKYQVRWKIIESSEGNSYTFVDPTQLPYNEKWEFPRNN
LQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLG
QHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSQEEPEGENGYKNVHL
EKKYICRDSGFSSQGMDTYVEMRPISTSSSNDPSEQGLDKEDGRLLELRDLLHFSSQVAQ
GMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAP
ESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKN
IYSIMQACWALEPTHRPTFQQICVLLQEQVQAATREQDYTNLPSGSASASASGGGSGSSS
SEHLACCEPGETAQPSLQPNNYQFC
NT seq 2418 nt   +upstreamnt  +downstreamnt
atggcttcaccatccacaaggccaaagttccttgagagccgggattactattgttgtgct
ctggtggacggcaagataatgaagtccatcggtattgagctcagagtgcagcaagtgctc
ccgggccccccctccttgacgttggcgcctgcggagctggtgcggattcagggggagact
gcttcgatcgtgtgctcggccagcaacctcgactacaacttcaacgtcttcctccaacgt
ggcgacaccaagctcgcgctctctgaagactccgacttccatgatggtagctaccataaa
gtcctgaccctcagcctcagtgacgtaagcttccaagatgcgggcaactacacctgcgtg
gccaccaacccccagggcacccgctcctcctccatggtcttccgggtggtagggagtgcc
tatgtgaacctgacctcgaagcagaacctattccaggaggtctcagtgggcgagaccctg
aacctccaagtgcaggtggaggcctacccagacctgcagagttttaactggacttacctg
gggcctttctccgactatgagcccaagcttgagtttatcaccaacaaggacatgtacagg
tacacgtccagcctctccctgcgccgtctgaagcccaccgaggccggccgctactgcttc
ctggccaggaacgtgggtggctccagtgctctgaccttcgagctcgccctgcaatacccc
ccagcagtgaccctcaccaggaccctagtcaatggctcagacgccctcttctgtgatgtg
tccgggtacccccagcccaacgtgacttggctgcagtgcaggggccatgctgacagatgt
gatgaggcccacgtgctgtggatctgggaggacccgtcgcccaaggtgctgagccaggag
cccttccacaaagtgaccgtccagagcctgctgtccactgggtccctggaacacaacgtg
acctatgagtgcagggccctcaacaccgtgggcaacgactccgagaccttcaggcccgtc
tctataggagcctacgtgcagctccccgaggggtccctcttcacgccagtggtggtcgct
tgcctgtccgtcatggccttgctgctgctgctcctcttgctgctcttgtacaagtacaaa
cagaagcccaagtaccaggtgcgctggaagatcatcgagagctccgagggcaacagttac
accttcgtcgaccccacgcagctgccctacaatgagaagtgggagttcccccggaacaac
ctgcagtttggtaagaccctgggagccggcgccttcgggaaggtggtggaggccacggcc
tttggtctgggcaaggaagacgctgtgctgaaggtggctgtgaagatgctgaagtccact
gcccacgcggacgagaaggaggccctcatgtcggaactaaagatcatgagtcacctgggt
cagcacgagaacattgtcaacctgctgggagcctgcacccacggaggcccggtgctggtc
atcacggagtactgttgctatggcgacctgctcaacttcctgcggaggaaagcggaggcc
atgctgggacctagccaggaggaacccgagggggagaacggctacaagaatgtccacctg
gagaagaaatacatctgcagggacagtggcttttccagccagggcatggacacctacgtg
gaaatgaggcccatctccacgtcttcttcaaatgacccctccgagcaaggccttgacaag
gaagatggccggctgctggagctccgcgacctgctccacttctccagccaagtggcccag
ggcatggccttcctggcttccaagaactgcatccaccgggacgtagcagcccgcaacgtg
ctgctgaccagcggccatgtggccaagattggggactttgggctggctagggacatcatg
aacgactccaactacatcgtcaagggcaatgcccgcctgcctgtcaagtggatggccccg
gagagcatctttgactgtgtctacaccgtccagagcgatgtgtggtcctacggcatcctg
ctctgggagatcttctcactcgggctgaacccttaccctggcatcctggtgaacagcaag
ttctataaactggtgaaagacggataccaaatggcccagcctgcatttgcaccaaagaac
atatacagcatcatgcaggcctgctgggccctggagcccacacacagacccaccttccag
cagatctgcgtcctgcttcaggagcaagtccaagcggccacgagagagcaggactacacc
aatctgcctagtggcagtgccagtgccagtgccagtggcggcggcagcggcagcagcagc
agcgagcacctggcctgctgtgagcccggggagacggcccagccctcgctgcagcccaat
aactaccagttctgctga

DBGET integrated database retrieval system