Oryctolagus cuniculus (rabbit): 100341005 Help Entry 100341005         CDS       T03373                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04613   Neutrophil extracellular trap formation ocu05034   Alcoholism ocu05202   Transcriptional misregulation in cancer ocu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ocu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100341005  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100341005   09163 Immune disease    05322 Systemic lupus erythematosus     100341005   09165 Substance dependence    05034 Alcoholism     100341005  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100341005   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100341005 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100341005 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100341005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100341005 NCBI-ProteinID:  XP_002712259 Ensembl:  ENSOCUG00000027587 UniProt:  G1TNW5 LinkDB All DBs Position 7:complement(113963017..113963767) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLHFQSAAIGALQEASEAYLAGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgactggtggtaaagcacccaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcccggtactgtggcacttcgtgaaatcagacgttatcagaagtccactgag cttctgattcgcaaactccccttccagcgtctggtgcgagaaatcgctcaggacttcaaa acagatctgcacttccagagcgcagctattggtgctttgcaggaggcaagcgaggcctat ctggctggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system