KEGG   Oryctolagus cuniculus (rabbit): 100341057
Entry
100341057         CDS       T03373                                 
Symbol
UBE2M
Name
(RefSeq) ubiquitin conjugating enzyme E2 M
  KO
K10579  ubiquitin-conjugating enzyme E2 M [EC:2.3.2.34]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100341057 (UBE2M)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100341057 (UBE2M)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.34  E2 NEDD8-conjugating enzyme
     100341057 (UBE2M)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   100341057 (UBE2M)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 100341057
NCBI-ProteinID: XP_002721946
Ensembl: ENSOCUG00000016628
LinkDB
Position
Un
AA seq 183 aa
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNF
KLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWK
PVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFER
CLK
NT seq 552 nt   +upstreamnt  +downstreamnt
atgatcaagctgttctcgctgaagcagcagaagaaggaggaggagtcggcgggcggcacc
aagggcagcagcaagaaggcgtcggcggcgcagctgcggattcagaaggacataaacgag
ctgaacttgcccaagacgtgtgacatcagcttctcagacccagacgacctcctcaatttc
aagctggtcatctgtcctgatgagggcttctacaagagcgggaagtttgtattcagtttt
aaggtgggccagggttacccacatgacccccccaaggtgaagtgtgagacgatggtctat
caccccaacattgacctcgagggcaacgtctgcctcaacatcctcagagaggactggaag
ccagtccttacgataaactccataatttatggcctgcagtatcttttcttggagcccaac
cctgaggacccactgaacaaggaggccgccgaggtcctgcagaacaaccggcggctgttt
gagcagaatgtgcagcgctccatgcgaggtggctacatcggctccacctacttcgagcgc
tgcctgaaatag

DBGET integrated database retrieval system