KEGG   Oryctolagus cuniculus (rabbit): 100341137
Entry
100341137         CDS       T03373                                 
Symbol
RAB4A
Name
(RefSeq) RAB4A, member RAS oncogene family
  KO
K07879  Ras-related protein Rab-4A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100341137 (RAB4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100341137 (RAB4A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ocu04031]
    100341137 (RAB4A)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    100341137 (RAB4A)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    100341137 (RAB4A)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA PduV-EutP AAA_7 SRPRB AAA_16 AAA_22 Septin ATPase_2 ATPase DUF2075 NACHT
Other DBs
NCBI-GeneID: 100341137
NCBI-ProteinID: XP_008249062
Ensembl: ENSOCUG00000006816
UniProt: G1SRS3
LinkDB
Position
Un
AA seq 218 aa
MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGK
YVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQSIV
IILCGNKRDLDAEREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIES
GELDPERMGSGIQYGDAALRQLRSPRRAQAPSAQECGC
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtcgcagacggccatgtccgaaacctacgatttcttgtttaagttcttggttattgga
aacgcgggaactggcaaatcttgcttacttcatcagttcattgaaaaaaaattcaaagat
gactcaaatcatacaataggagtggaatttggttcaaagataataaatgttggtggtaaa
tatgtaaagttacagatatgggatactgcaggacaagaacgattcaggtcggtgacgagg
agctactacagaggcgcggccggggctctgctggtctacgacatcaccagccgagaaacc
tacaatgcgcttactaattggttaacagatgccagaatgctagcgagccagagcatcgtg
atcatcctgtgcgggaacaagagggacctggatgccgagcgcgaggtcaccttcctggaa
gcctccaggttcgcccaggaaaatgagctgatgtttctggaaacgagtgcactgacgggg
gagaatgtagaagaggcttttgtgcagtgtgcacgaaaaatacttaacaagattgagtca
ggtgagctggacccagaaagaatgggctcaggtatccagtatggagatgctgccttgaga
cagctgaggtccccgcggcgcgcccaggccccaagtgcccaggagtgtggctgttag

DBGET integrated database retrieval system