Oryctolagus cuniculus (rabbit): 100341175 Help Entry 100341175         CDS       T03373                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100341175  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100341175    04215 Apoptosis - multiple species     100341175    04115 p53 signaling pathway     100341175  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100341175   09162 Cancer: specific types    05210 Colorectal cancer     100341175    05222 Small cell lung cancer     100341175   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100341175    05161 Hepatitis B     100341175    05160 Hepatitis C     100341175    05164 Influenza A     100341175    05162 Measles     100341175    05168 Herpes simplex virus 1 infection     100341175    05163 Human cytomegalovirus infection     100341175    05167 Kaposi sarcoma-associated herpesvirus infection     100341175    05169 Epstein-Barr virus infection     100341175   09171 Infectious disease: bacterial    05132 Salmonella infection     100341175    05134 Legionellosis     100341175    05152 Tuberculosis     100341175   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100341175   09164 Neurodegenerative disease    05010 Alzheimer disease     100341175    05012 Parkinson disease     100341175    05014 Amyotrophic lateral sclerosis     100341175    05016 Huntington disease     100341175    05017 Spinocerebellar ataxia     100341175    05020 Prion disease     100341175    05022 Pathways of neurodegeneration - multiple diseases     100341175   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100341175    05416 Viral myocarditis     100341175   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100341175   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100341175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100341175 NCBI-ProteinID:  XP_002713768 Ensembl:  ENSOCUG00000025605 UniProt:  G1U0B4 LinkDB All DBs Position 10:complement(7051993..7054420) Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa aaagctacgaatgagtaa

DBGET integrated database retrieval system