KEGG   Oryctolagus cuniculus (rabbit): 100341235
Entry
100341235         CDS       T03373                                 
Symbol
TNFRSF13B
Name
(RefSeq) TNF receptor superfamily member 13B
  KO
K05150  tumor necrosis factor receptor superfamily member 13B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04672  Intestinal immune network for IgA production
ocu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341235 (TNFRSF13B)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100341235 (TNFRSF13B)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100341235 (TNFRSF13B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100341235 (TNFRSF13B)
   04090 CD molecules [BR:ocu04090]
    100341235 (TNFRSF13B)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100341235 (TNFRSF13B)
CD molecules [BR:ocu04090]
 Proteins
  100341235 (TNFRSF13B)
SSDB
Motif
Pfam: TACI-CRD2 BaffR-Tall_bind BCMA-Tall_bind
Other DBs
NCBI-GeneID: 100341235
NCBI-ProteinID: XP_008250513
Ensembl: ENSOCUG00000021728
LinkDB
Position
Un
AA seq 296 aa
MSGRSSSSRRPEQARRPEPGSRRERSPQGPWTGLAMSSCPEEQFWDPLLNTCVSCKPMCS
HRSQRTCAAFCKSLSCHKEPGRYYDPLLRDCVSCVSVCGQHPKPCAHFCDGRIRGRGGLS
PELRQQQDGESEARADSTGRYQGSEHRGLEAAPAPLVPRLSAHQLALVYSTLGVCLCAII
CCFLVAVACFLKRRGDQVSCQPPAGRPRAKPSQDPAMEAGPATCAPPGPVETCSFCFPER
RAPTQESSATPETPRPAVAESLGRCPGTAAPRSCARAPDGGLGPLCAPAQEGSLGV
NT seq 891 nt   +upstreamnt  +downstreamnt
atgagtggtcgcagcagcagcagccgccggcccgagcaggcgaggcggccggagccgggc
agccgcagggagcggtctccgcagggcccgtggacggggctggctatgagttcctgcccc
gaagagcagttctgggaccccctgctgaacacctgtgtctcctgcaaacccatgtgcagc
caccggagccagcgcacctgtgcggccttctgcaagtcgctcagctgccacaaggagcca
ggcagatactacgaccccctgctgcgggactgcgtcagctgcgtctccgtgtgcggccag
caccccaagccgtgcgcccacttctgtgacggccggatccggggccgagggggcctctcg
cccgagctcaggcagcagcaggatggggagtcggaggccagggcggacagcacgggaagg
taccagggatccgagcacagaggcttggaggccgctccagcgccgctggtgcccaggctg
agcgcgcaccagctggccctggtctacagcacgctgggggtctgcctgtgcgccatcatc
tgctgcttcttggtggccgtggcctgcttcctcaagaggaggggcgaccaggtttcctgc
cagcccccggcagggagaccccgggccaagccttcccaagatcccgcgatggaagccggc
cccgcaacatgcgcgccgcccggcccggtggagacctgcagcttctgtttccccgagcgc
agggcgcccactcaggagagctcagccacgcccgagacgccccggcccgcggtcgctgag
agcctggggcgctgccccgggaccgccgccccgcggtcgtgcgcgcgcgccccggacggc
ggcctcggcccgctgtgcgcgcccgcccaggaggggagcctgggcgtttga

DBGET integrated database retrieval system