KEGG   Oryctolagus cuniculus (rabbit): 100341271
Entry
100341271         CDS       T03373                                 
Symbol
IL20RA
Name
(RefSeq) interleukin 20 receptor subunit alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100341271 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341271 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100341271 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100341271 (IL20RA)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL10/28 receptor family
   100341271 (IL20RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 100341271
NCBI-ProteinID: XP_008261791
Ensembl: ENSOCUG00000015696
UniProt: G1TA02
LinkDB
Position
12:complement(127458733..127501436)
AA seq 548 aa
MRAPRCPERGRPALQLLLLLLFAAAPPGSAVPCVSGDLPKPTDVTFLSINMKNVLQWNPP
EGLHGVDVTYTVQYFIYGQKKWLNKPECRNINRTFCDLSAETSDYEHQYYAKVKAIWETN
CSKWAETGRFYPFLETQIGPPGVALTPDEKSISIVLTAPEKWKKNPEDRAVSMQQIYSNL
KYNVSVYNTKSKRMWSQYVTNHTLVLTWLEPATLYCVRVVSFVPGPPRPAKPSEKQCIST
LQDQTSALKVKIIFWYVLPISVAVFLFSVMGYSIYRYIHVGKEKHPANLILIYGNEVDKI
FFVPPEKIMINFITLNILDDSKTPQKNMSFLEEGRDGFSLKDSDPSWELESQQEDIEVKH
FGYASHVVEIFCDSRKSPRSSSLIQQESLSRTIPRDQTVMEDEYDIKNDIWWEHRDQKEA
AIHGMPLMQQVALANLDLQMLLHSYTPQLRDLEHLAQGQRDSEEEPEEEPSMTVVDWDPQ
TGRLCIPSLPSFDQEPKGCEHSDCDGPMEESLLSRLFEKQAADKTPEEEEAYLMQFMEEW
GLYVQMEN
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgcgcgccccccggtgccccgagcgcggccgcccggccctgcagctgctgctgctgctg
ctgttcgcggcggcgccgccgggaagcgcagttccctgtgtctctggtgatttgcctaag
cctacagatgtcaccttcttgtccataaacatgaagaatgttctacagtggaacccacca
gagggtctacatggagttgatgttacctacactgtgcagtatttcatatatggacaaaag
aaatggctgaataaacccgaatgcagaaatatcaatagaaccttctgtgatctttctgct
gaaacctccgactatgaacaccagtattatgccaaagtgaaggccatttgggaaacgaat
tgctccaaatgggctgagactggccgattttatccctttttagaaacacaaattggcccc
ccaggcgttgctctgactcctgatgagaagtccatttctattgtcctgacggctccagag
aagtggaagaaaaatccagaagaccgtgctgtgtccatgcaacagatatactccaacctg
aagtacaatgtgtccgtgtacaacaccaaatccaaaagaatgtggtcccagtacgtgacc
aaccacacgctggtgctcacctggctggagccggccactctgtactgtgtgcgtgtggtg
tcgttcgtgccggggccgcctcgccctgctaagccttccgagaagcagtgtatcagtaca
ttgcaagatcaaacatcagcgctaaaggttaaaatcatcttctggtatgttttgccaata
tctgtggccgtgtttctcttttctgtgatgggatattccatctaccgatatatccacgtt
ggcaaagagaaacacccagcaaatttgattttgatctatggaaatgaagttgacaaaata
ttctttgtgcctcctgaaaaaatcatgattaattttatcaccctcaacattctggatgat
tctaaaactccccagaagaatatgagtttcctggaagaaggtagggatggattcagcctt
aaggattcagatcccagctgggagctggagtcccagcaggaggacatagaggtgaaacac
ttcgggtatgcatcacatgtggtggaaattttctgtgactctcggaaaagccccagaagc
tcttccctaatccagcaagagtcactgagcagaacgatacccagagatcaaactgtcatg
gaagatgaatatgatataaaaaacgacatttggtgggaacacagagatcagaaggaggca
gccatacatggaatgccactcatgcaacaggtagctctggcaaacttggatctacaaatg
ttactgcattcatatacccctcagcttagagacttggagcacctggcacaggggcaaaga
gactcagaagaggagccggaggaggagccatcgatgacagtggtggattgggaccctcag
actggccggctgtgtataccttccttacctagctttgaccaggagcccaagggctgtgag
cattccgactgtgatggacccatggaggagagcctgctatccaggctctttgagaagcag
gcagctgacaagacacctgaagaagaggaagcctatctcatgcagtttatggaggaatgg
ggattatatgtacaaatggaaaactaa

DBGET integrated database retrieval system