KEGG   Oryctolagus cuniculus (rabbit): 100341307
Entry
100341307         CDS       T03373                                 
Symbol
TRIM32
Name
(RefSeq) tripartite motif containing 32
  KO
K10607  tripartite motif-containing protein 32 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100341307 (TRIM32)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100341307 (TRIM32)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100341307 (TRIM32)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    100341307 (TRIM32)
SSDB
Motif
Pfam: NHL zf-RING_UBOX zf-RING_2 zf-RING_5 zf-C3HC4 zf-B_box zf-C3HC4_2 Baculo_IE-1 Prok-RING_4 zf-RING_4 zf-C3HC4_4 zf-RING_11 zf-RING_10 FAM184 Zn_Tnp_IS1595 IBR Haem_bd Phage_capsid zf-Nse
Other DBs
NCBI-GeneID: 100341307
NCBI-ProteinID: XP_002720557
Ensembl: ENSOCUG00000000866
LinkDB
Position
Un
AA seq 653 aa
MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVR
CPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRACGRRLPRQFCRSCGLVLC
EPCREADHQPPGHSTLPVKEAAEERRRDFGEKLTRLRELMEELQRRKVALEGVSKDLQAR
YKAVLQEYGHEERRVQDELARSRKFFTGSLAEVEKSNTQVVEEQSYLLNIAEVQAVSRCD
YFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRT
VNMEDSWAMEAAASAASTSVTFREMDMSPEEVAASPRASPAKHRGPEATSNIQQCLFLKK
MGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDGFVLS
FLGADLPNLTPLSVAMNCHGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPS
GQFVVTDVEGGKLWCFTVDRGAGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENR
QNEHHLEGGFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEIL
HFPKGGGFSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP
NT seq 1962 nt   +upstreamnt  +downstreamnt
atggccgcagcagcagcgtctcacttgaacctggatgctctccgggaagtgctggaatgc
cccatttgtatggagtccttcacggaagagcagctgcgacctaagctcctgcactgtggt
cataccatctgccgccagtgcctggagaagctcctggccagtagcatcaatggtgtccgc
tgtcccttttgcagcaagattacccgcattaccagcctgacccagctcacagacaacctg
actgtgctgaagatcatcgacacagctggactcagtgaggctgtagggctgcttatgtgc
cgcgcttgtgggcggcggctgccccggcagttctgccgcagctgtggcttggtgttgtgt
gagccctgccgggaagcagaccaccaacctcctggccacagtacacttcctgtcaaagag
gcagcagaggagcggcgtcgagactttggagagaagttaacccgtctgagggagctcatg
gaagagctgcagcggcggaaagtagccttagaaggcgtgtccaaggaccttcaagcaaga
tacaaagcagttcttcaggagtacgggcatgaggagcgcagggtccaggatgagctggcc
cgttctcggaagtttttcacaggctctttggctgaagttgagaagtccaatactcaagtt
gttgaggaacagagttacctgcttaacattgcagaggtccaggcggtgtctcgctgtgac
tacttcctggccaagatcaagcaggcagatgtggcactcctggaggagacagctgatgag
gaagagccagagctcactgccagcttgccccgggagctcaccctacaagatgtggagctc
cttaaggtaggtcatgtcggccccctccaaattgggcaggcagttaaaaagccccgaaca
gttaacatggaagattcctgggccatggaggctgcagcttctgctgcctctacttctgtt
acatttagagagatggacatgagccctgaggaagtagctgccagccctagggcctcacct
gctaaacaccgaggtcctgaggccacttccaatatccagcagtgcctatttctcaagaag
atgggggccaaaggcagcactccaggcatgttcaatcttccagtcagtctgtatgtgacc
agtcaaggggaggtgctggttgctgaccgtggtaactaccgcatacaagtctttactcgc
aaaggatttttgaaggagatccgccgcagccccagtggcattgatggctttgtgctaagc
ttcctgggggctgatttgcccaatctcactcctctctcagtggccatgaactgccatggg
ctgattggtgtgactgacagctatgacaactccctcaaggtatataccttggatggccac
tgcgtggcctgtcacagaagccagctgagcaaaccatggggtatcacagccctgccatct
ggtcagtttgtggtaactgatgtagaagggggaaagctttggtgtttcactgttgaccga
ggagcaggggtggtcaaatacagctgcctctgcagtgctgtgcggcccaagtttgtcacc
tgtgatgctgaaggcaccgtctacttcacccagggcttaggcctcaatctggagaatcgg
cagaatgagcaccacctggagggtggcttctccattggctctgtgggccctgatgggcag
ctgggtcgccagatcagccacttcttctcagagaatgaggacttccgctgcattgctggc
atgtgtgtggatgctcgtggtgacctcatcgtggctgacagtagtcgcaaggaaatcctc
cattttcctaagggtgggggctttagtgtccttattcgagagggactcacctgtcctgtg
ggtattgccctcactcctaagggacagctgctagtcttggattgttgggatcattgtatc
aagatctacagctatcatctgagaagatattccaccccctag

DBGET integrated database retrieval system