KEGG   Oryctolagus cuniculus (rabbit): 100341420
Entry
100341420         CDS       T03373                                 
Name
(RefSeq) interferon lambda-1-like
  KO
K05447  interferon lambda 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100341420
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100341420
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100341420
SSDB
Motif
Pfam: IL28A
Other DBs
NCBI-GeneID: 100341420
NCBI-ProteinID: XP_002711513
Ensembl: ENSOCUG00000012894
LinkDB
Position
5:complement(657679..658987)
AA seq 203 aa
MAVSLNLMVPVLLVVVLNAARAGPVPPTKPATAGRDCRIDSFKSLSPRELEAFKTARDAL
EESLLLKSRRAPDPPRAPPPAPLLRAPPPEWERPEALEAELFMSLKVLEAMEDSARGHVL
EQPLRTLRHIHTQLRGLSPQQTASAHHPPVPKRRGRLHPLATPGSQEAPKKEAPACLEAS
VIFILFRLLTRDLKCVASGPLCV
NT seq 612 nt   +upstreamnt  +downstreamnt
atggctgtgtctctgaacctgatggtgccggtgctgctggtggtggtgctgaacgcggcc
agagcgggccccgtcccccccaccaagcccgccacagccgggagagactgccgcatcgac
agcttcaagtctctctctccacgggagctggaggccttcaagacagccagggatgccttg
gaagagtcactgttgctcaagagccgcagagccccggaccctccccgagcccctcctccc
gcgcctctcctccgcgcccctcctcctgagtgggagcgccccgaggccctggaggctgag
ctgttcatgtcgctgaaggttctggaagccatggaggactcagcccgggggcacgtcctg
gagcagcccctccgcacactgcgccacatccatacccagctgcggggcctgtctccccag
cagaccgcctcagcccaccaccccccggtccccaagcgccggggccgcctccacccactg
gctacacccggctcccaggaggcccccaagaaggaggcccccgcctgcctcgaggcctct
gtcatcttcatcctcttccgcctgctcacgcgggacctgaagtgtgtagccagtggaccc
ctgtgcgtctga

DBGET integrated database retrieval system