KEGG   Oryctolagus cuniculus (rabbit): 100341426
Entry
100341426         CDS       T03373                                 
Symbol
INHBB
Name
(RefSeq) inhibin beta B subunit
  KO
K22687  inhibin beta B chain
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100341426 (INHBB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341426 (INHBB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100341426 (INHBB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100341426 (INHBB)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100341426 (INHBB)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide DUF411 TctA
Other DBs
NCBI-GeneID: 100341426
NCBI-ProteinID: XP_008256688
Ensembl: ENSOCUG00000005094
LinkDB
Position
7:complement(62748332..62753536)
AA seq 407 aa
MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPSPAAPPPPPPPGAPGGSQDTCASCGG
FRRPEELGRMDGDFLEAVKRHILNRLQLRGRPNITHAVPKAAMVTALRKLHAGKVREDGR
VEIPHLDGHASPGADGQERVSEIISFAEADGLASSRVRLSFFVSNEGNQNLFVVQASLWL
YLKLLPYVLEKGSRRKVRVKVYFQEQGHGDRWNVVEKKVDLKRSGWHTFPLTDAIQALFE
RGERRLNLDVQCDSCGELAVAPVFVDPGEESHRPFVVVQARLGDSRHRIRKRGLECDGRT
NLCCRQQFFIDFRLIGWHDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRM
RGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggacgggctgcccgggcgggcgttgggggccgcctgcctgctgctgctggcggccggc
tggctggggcccgaggcctggggctcgcccacgcccccgccgtcgcccgctgcgccgccg
ccgcccccgccgcccggagccccgggcggctcacaggacacctgtgcgtcgtgcggcggc
ttccggcggcccgaggagctgggccggatggacggcgacttcctggaggcggtgaagcgg
cacatcttgaaccgcctgcagttgcggggccggcccaacatcacgcacgccgtgcccaag
gccgccatggtcacggccctgcgaaagctgcacgcaggcaaggtgcgcgaggacgggcgc
gtggagattccgcacctcgacggccatgccagcccgggcgccgacggccaggagcgcgtc
tcggaaattatcagctttgccgaggcagatggcctcgcctcctccagggtccgcctgtcc
ttcttcgtctccaatgaaggcaaccagaacctgtttgtggtccaggccagcctgtggctg
tacctgaagctgctgccctacgtgttggagaagggcagccggcggaaggtgcgggtcaag
gtgtacttccaggagcagggccacggcgacaggtggaacgtggtggagaagaaggtggac
ctgaaacgcagcggctggcacaccttcccgctcaccgacgccatccaggccttgttcgag
cgcggtgagcggcggctcaacctggacgtgcagtgcgatagctgcggggagctggccgtg
gcgccagtgttcgtggaccccggcgaggagtcgcaccggcccttcgtggtggtgcaggcc
cggctcggggacagccggcaccgcattcgcaagcgaggcctggagtgcgacgggcggacc
aacctctgttgcaggcaacagttcttcatcgacttccggctcatcggctggcacgattgg
atcattgcgcccacgggctactacggcaactactgcgagggcagctgcccggcctacctg
gcgggggtccccggctccgcctcctccttccacacggccgtggtgaaccaataccgcatg
cggggcctgaatcccggcccggtgaactcctgctgcatccccaccaagctgagctccatg
tccatgctgtacttcgacgacgagtacaacatcgtgaagcgggacgtgcccaacatgatc
gtggaggagtgcggctgcgcctga

DBGET integrated database retrieval system