KEGG   Oryctolagus cuniculus (rabbit): 100341427
Entry
100341427         CDS       T03373                                 
Symbol
TRIP12
Name
(RefSeq) thyroid hormone receptor interactor 12
  KO
K10590  E3 ubiquitin-protein ligase TRIP12 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100341427 (TRIP12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100341427 (TRIP12)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100341427 (TRIP12)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100341427 (TRIP12)
SSDB
Motif
Pfam: HECT WWE HEAT_2
Other DBs
NCBI-GeneID: 100341427
NCBI-ProteinID: XP_017198671
Ensembl: ENSOCUG00000016726
LinkDB
Position
7:complement(171741644..171893734)
AA seq 2068 aa
MSNRPNNNPGGSLRRSQRNTAGAQPQDDAVGGRSHLGQAKHKGYSPPESRKSNSKAPKVQ
SNTTTELSRGHLSKRSCSSSSAVIVPQPEDPERANTSERQKTGQVPKKDNSRGVKRSASP
DYNRTNSPSSAKKPKALQHTESPSETKKPHSKSKKRHLDQEQQLKSAQLPSTSKAHTRKS
GATGSSRSQKRKRTESSCVKSASGSESTGAEERSAKPTKLASKSAASAKAGCSTITDSSS
AASTSSSSSAVASVSSTVPPGARVKQGKDQNKARRSRSASSPSPRRSSREKEQSKTGGSS
KFDWAARFSPKVSLPKTKLSLPGSSKSETSKPGPSGLQAKLASLRKSTKKRSESPPAELP
SLRRSTRQKTTGSCASTSRRGSGLGKRGAAETRRQEKMADPESNQEAVNSSAARTDEAPQ
GAAASSSVAGAVGMTTSGESESDDSEMGRLQALLEARGLPPHLFGPLGPRMSQLFHRTIG
SGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQME
HNFDIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRR
HSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLT
HQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTPPILSSGMFIMVV
RMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLIC
ELMPCLPKEGIFAVDTMLKKGNAQNTDGAIWQWRDDRGLWHPYNRIDSRIIEVAAHQVGE
DEISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLANTNTSGHSESKKDDARAQLM
KEDPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIYFADAELLKDVLKNHAVS
SHIASMLSSQDLKIVVGALQMAEILMQKLSDIFSVYFRREGVMHQVKHLAESEALLTSPP
KVCTNGSGSLGSTTSVSSATATAATNATADLGSPSLQHSRDDSLDLSPQGRLSDVLKRKR
LPKRGPRRPKYSPPRDDDKVDNQAKSPTTTQSPKSSFLASLNPKTWGRLSAQSNSNNIEP
ARTAGVSGLARAAAKDTISNNREKIKGWIKEQAHKFVERYFSSENMDGSNPALNVLQRLC
AATEQLNLQVDGGAECLVEIRSIVSESDVSSFEIQHSGFVKQLLLYLTSKSEKDAVSREI
RLKRFLHVFFSSPLPGEEPIGRVEPVGNAPLLALVHKMNNCLSQMEQFPVKVHDFPSGNG
TGGSFSLNRGSQALKFFNTHQLKCQLQRHPDCANVKQWKGGPVKIDPLALVQAIERYLVV
RGYGRVREDDEDSDDEGSDEEIDESLAAQFLNSGNVRHRLQFYIGEHLLPYNMTVYQAVR
QFSIQAEDERESTDDESNPLGRAGIWTKTHTIWYKPVREDEESNKDCVGGKRGRAQTAPT
KTSPRNAKKHDELWHDGVCPSVSNPLEVYLIPTPPENITFEDPSLDVILLLRVLHAISRY
WYYLYDNAMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPF
DTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAES
VMQDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQ
EGTKYIQNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYK
WMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNG
CSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDG
FESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFEILS
SFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLK
LPDYSSIEIMRDKLLTAAREGQQSFHLS
NT seq 6207 nt   +upstreamnt  +downstreamnt
atgtccaaccggcctaataacaatccaggggggtcactgcgacgttcacagaggaacact
gccggggcccaaccacaagacgacgcggtaggaggaaggtcacatttagggcaggcaaaa
cataagggatatagccctcctgagagtagaaaatctaattctaaggcacccaaagtgcag
tctaatactactactgagctgtcaaggggacacctttctaaaagaagctgcagttcatca
tctgctgtcatagttccacaaccagaggatccagagagagccaatacttcagaaaggcag
aaaacggggcaagtgcctaagaaagacaattctcgaggagtgaaacgcagcgctagtcca
gactacaacaggaccaattctcctagctctgcgaaaaaacccaaagcacttcagcatact
gaatctccatcagaaacgaagaagccacatagtaagtcaaagaagagacatttagaccag
gagcaacagctgaaatctgcacaattgccgtcaacaagcaaggctcacaccagaaagagt
ggggccactggtagttcacggagtcagaaaagaaagaggacagaaagttcttgtgtaaag
agtgcttctgggtccgaatcaactggtgccgaagagagatctgcaaaacctaccaagctg
gcttcaaaatcagccgcctcagccaaagctgggtgtagcaccatcaccgattcttcttct
gctgcctctacttcctcctcatcttctgctgttgcctccgtctcctccactgtaccacca
ggagccagggtgaaacaaggaaaagaccagaacaaggccaggcgttcccgttcagcatcc
agtcccagtcccagaagaagtagcagggaaaaggaacagagtaaaactggtggctcttca
aaatttgattgggctgctcgtttcagcccgaaagttagccttcctaaaacaaaactgtct
cttccagggtcttctaagtcagagacatcaaaacctggaccttctggattacaggccaaa
ttagcaagtttaaggaaatctaccaagaaacgcagtgagtccccacctgccgagctcccc
agtttgaggaggagcacacgccaaaagaccacgggctcctgtgctagtaccagtcggcga
ggctctggcctgggcaaaagaggagcagctgagactcgtcgacaggaaaaaatggcagat
cctgaaagcaaccaggaggcagtaaattcttcagctgcacggacagatgaagctccccaa
ggagctgcagcctctagttctgttgcaggggctgttggcatgaccacttctggggagagt
gaatcagatgattccgagatgggacgattgcaagctctgttagaggccaggggtcttcct
cctcacctgtttggtcctcttggtcctcggatgtcacaacttttccatagaacaattgga
agcggagctagttctaaggcccagcagcttctacaaggactgcaagccagtgatgaaagt
cagcagctgcaggcagttattgaaatgtgtcagttgttggtcatgggcaatgaggagaca
ctgggagggtttcctgtcaagagtgttgttccagctttgataacgttactacagatggaa
cataatttcgatattatgaaccatgcttgtcgagccttaacatacatgatggaagcactt
cctcgatcgtctgctgttgtggtagatgctattcctgtcttcttagaaaagctgcaagtt
attcagtgtatcgatgtggcagagcaggccttgactgccttggaaatgttgtcacggaga
cacagtaaagccattctacaggcgggtggtttggcagactgcttgctgtatctagaattc
ttcagcatcaatgcccaaagaaatgcactagcaattgcggccaactgctgccaaagtatc
acaccagatgaatttcattttgtggcagattccctcccgttgcttacccaaaggctaact
catcaggacaaaaagtcagtagaaagcacttgcctttgttttgcacgtcttgtggacaac
ttccaacatgaggagaatttactccagcaggttgcttccaaagatctgcttacaaatgtt
caacagctgttggtagtgactccacccattttgagttctgggatgtttataatggtggtt
cgaatgttttctctgatgtgctctaactgtccaacattagctgttcaacttatgaagcag
aacattgcagaaacgcttcacttcctcttgtgtggtgcctccaatggaagttgtcaggag
cagattgatcttgttccacggagtcctcaagaactatatgaactgacatctctgatttgt
gaacttatgccgtgtttaccaaaagaaggcatttttgcagttgataccatgttgaagaaa
ggaaatgcacagaacacagatggtgcgatatggcagtggcgtgatgaccggggcctgtgg
catccctataacaggattgacagccggatcattgaggtagcagcccatcaggtcggtgag
gatgagataagcttgtccactctgggacgagtttatactattgattttaattctatgcag
caaatcaatgaggacacgggaacagcacgtgccattcaaagaaaacctaaccccttagcc
aatactaacactagtggacattcagagtcaaagaaggacgatgctcgagcacagcttatg
aaagaggatccggagctggctaaatctttcattaagacgttgtttggtgttctttatgaa
gtgtatagttcctcagcaggacctgcggtcagacataagtgccttagagcaattcttaga
ataatttattttgcggatgccgaacttctgaaggatgttctgaaaaatcatgctgtttca
agtcatattgcttccatgctatcaagccaagacctgaagatagtagtcggagcacttcag
atggcagaaatcttaatgcagaagttatctgatatttttagtgtttacttcagaagagaa
ggtgtaatgcaccaggtaaaacacctagcggaatccgaggctttgttgacaagtccacca
aaggtgtgtacgaatggatcaggatccttggggtccacaacgtcggtcagcagtgcaaca
gctacagctgccactaatgccacggctgacttgggatcacccagcctgcagcacagcaga
gatgactctctagatctgagccctcaaggtcgattaagtgatgtcctaaagaggaaacga
ctgccaaaacgaggaccacgaaggccaaagtactcccctccaagagatgacgacaaagta
gacaatcaagctaaaagccccaccactactcagtcacctaaatcttctttcctggcaagc
ttgaatccaaaaacatggggaaggctcagcgcacagtccaacagcaacaatatcgagcca
gcgcggactgcaggagttagtggtcttgccagggctgctgcaaaggacactatatccaat
aatagggaaaagattaaaggttggattaaggaacaggcccataaatttgtagaacgttac
ttcagttctgagaacatggatgggagcaaccctgccctgaatgtcctccagagactttgt
gctgcaactgaacaactcaacctccaggtggatggtggagctgagtgccttgtagaaatt
cgtagcatagtctcggaatcagatgtttcatcatttgaaatccaacatagtggattcgtg
aagcagcttttactttacttgacatctaaaagtgaaaaagatgctgtgagcagagagatc
agattaaagagatttcttcatgtatttttttcttctccacttcctggagaagagccaatt
ggaagagtagaaccagtgggaaatgcacctttgttggcgttagttcacaaaatgaacaac
tgcctcagccagatggaacagtttccagtcaaagtacatgatttccctagtggaaatggg
acgggaggcagcttttctctcaacagaggatcacaggctttaaaattcttcaacacacat
cagttaaaatgccagttgcagagacatcctgactgtgcaaatgtgaagcagtggaaaggt
ggacctgtcaagattgaccccctggctttggtacaggctattgagagataccttgtggtc
agagggtatggaagagtgagagaagatgatgaagacagtgacgacgaggggtcagatgag
gagatagacgagtctctggctgctcagttcttaaattcaggaaatgtaagacacaggcta
cagttttacattggagaacatttgctaccatataacatgactgtgtatcaggcagtccgg
cagttcagtatacaggcggaagatgaaagagaatccacggatgatgagagcaatccccta
gggagagctggtatttggacaaagactcatacaatatggtacaaacctgtgagagaggat
gaagaaagtaataaagattgtgttggtggtaaaagaggaagagcccaaacagctccaaca
aaaacttcccctagaaatgcaaaaaagcatgatgagttatggcatgatggagtgtgtcca
tcagtatcaaaccctttagaagtttacctcattcccacaccacctgaaaatataacgttt
gaagacccgtcattagatgtgatccttcttttacgagttttacatgccatcagtcgatat
tggtattacttgtatgataatgcaatgtgcaaggagattattccaactagtgaatttatt
aacagtaaattgacagcaaaagcaaataggcagcttcaagatcctttagtaatcatgaca
ggaaatatccctacatggcttactgagctaggaaaaacttgcccatttttctttcctttt
gatactcggcaaatgcttttttatgtaactgcatttgatcgggaccgagcaatgcaaaga
ttacttgataccaacccagaaatcaaccagtctgattctcaagacagcagagttgcacct
agattggacagaaaaaaacgcactgtgaacagagaggagctgctgaaacaagccgagtct
gtgatgcaggacctgggcagttcccgggccatgttagagatccagtatgaaaatgaggtt
ggtacaggtcttggacctacgctggagttctatgcacttgtatctcaggagctgcagaga
gctgatctgggtctctggagaggtgaagaagtaactctgagcaatccgaaaggaagccaa
gaagggaccaagtacattcaaaatctccagggcctgtttgcacttccctttggtaggaca
gctaagccagctcatattgcaaaggttaagatgaagtttcgattcttaggaaaattaatg
gccaaggctatcatggatttcagattggtggaccttcctcttggtttacctttctataag
tggatgctacggcaggaaacttcattgacgtcacatgacttgtttgacattgacccagtt
gtagccagatcagtgtatcacctagaagacatcgtcagacagaagaaaagacttgaacaa
gataaatcccagaccaaagagagtctacagtatgcattagagaccctgaccatgaatggt
tgctcagtggaagatctaggattggatttcactctgcctgggtttcccaacattgagctg
aagaaaggagggaaggatatacccgtcacgatccacaatttagaggagtatctgagactg
gttatattctgggcactgaatgaaggtgtttctaggcaatttgattccttccgggatgga
tttgaatcagttttcccactcagtcatcttcagtacttctacccagaggaactggatcaa
ctgctatgtggcagtaaagcagacacgtgggatgcaaagacgttgatggagtgctgcagg
cctgatcacggttatactcacgacagtcgggctgtgaagttcctgtttgagattctcagt
agttttgataatgagcagcagaggttatttctccagtttgtgaccgggagcccaagattg
cctgttggaggattccggagtctgaatccacctttgacaattgtccggaagacattcgag
tcaacagaaaacccagatgacttcttaccctctgtgatgacctgtgtgaactatctcaaa
ctgccggactattcgagcattgagataatgcgagacaaactgctgacagcagcacgagaa
gggcagcagtcattccatctctcctga

DBGET integrated database retrieval system