KEGG   Oryctolagus cuniculus (rabbit): 100341530
Entry
100341530         CDS       T03373                                 
Symbol
UBE2J1
Name
(RefSeq) ubiquitin conjugating enzyme E2 J1
  KO
K10578  ubiquitin-conjugating enzyme E2 J1 [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100341530 (UBE2J1)
   04120 Ubiquitin mediated proteolysis
    100341530 (UBE2J1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100341530 (UBE2J1)
   05022 Pathways of neurodegeneration - multiple diseases
    100341530 (UBE2J1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100341530 (UBE2J1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100341530 (UBE2J1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100341530 (UBE2J1)
SSDB
Motif
Pfam: UQ_con RWD ATPase-cat_bd
Other DBs
NCBI-GeneID: 100341530
NCBI-ProteinID: XP_002714624
Ensembl: ENSOCUG00000005288
UniProt: G1SNL4
LinkDB
Position
12:complement(76156787..76182976)
AA seq 318 aa
METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHG
RIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMP
TKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELA
RQISFKAEVNSAGKTLAEADLNHSFSLNDLQDDRPTTFQGATASTSLGVQNPSAASFEQP
TLPAAKNTSMSPRQRRAQQQSQSRPSASPDATPGPQPRDNHTDHGGSAVLIVILTLALAA
LIFRRIYLANEYIFDFEL
NT seq 957 nt   +upstreamnt  +downstreamnt
atggagacccgctacaacctgaagagtccggctgttaaacgattaatgaaagaagcagcg
gaattaaaagatccaacagatcattaccatgcgcagcctttagaggataacctgtttgaa
tggcacttcacagtcagagggcctccagattctgattttgacggaggagtttatcatgga
cgaatagtactgccaccagagtatcccatgaaaccgcctagcattattctcctcacggct
aatggacgatttgaagtgggcaagaaaatctgtttgagcatctcaggacatcatcctgaa
acctggcagccttcgtggagcataaggacagcattattagccatcattgggtttatgcca
acaaagggagagggagccataggttctctagactacacacctgaggaaagaagagcactt
gccaaaaaatcacaggatttctgttgtgaagggtgtggctctgccatgaaggatgtcctg
ttgcctttaaaatctggaagcgattcaagccaggctgatcaagaagccaaggagctggct
agacagatcagttttaaggcagaagtcaactcagcaggcaagactctcgctgaggcagac
ctgaaccactcgttttcattaaatgatttacaagatgatagacctacaacattccagggt
gctacagccagcacgtcgcttggagtccagaatccctcggcagcatcctttgaacaacct
accctgcctgcagctaagaatacctccatgagccctcgacagcgcagggcccagcagcag
agtcagagcaggccatccgcttccccagacgccacgccaggcccgcagcccagagacaac
cacactgatcacggcggatcggctgttctgatcgtcatcctgactttggcattggccgct
cttatattccgacgaatatatctggccaatgagtacatatttgactttgagttatag

DBGET integrated database retrieval system