KEGG   Oryctolagus cuniculus (rabbit): 100341540
Entry
100341540         CDS       T03373                                 
Symbol
PDCD6IP
Name
(RefSeq) programmed cell death 6 interacting protein
  KO
K12200  programmed cell death 6-interacting protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03250  Viral life cycle - HIV-1
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    100341540 (PDCD6IP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100341540 (PDCD6IP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100341540 (PDCD6IP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100341540 (PDCD6IP)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT associated proteins
    100341540 (PDCD6IP)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100341540 (PDCD6IP)
SSDB
Motif
Pfam: BRO1 ALIX_LYPXL_bnd Tex_N AAT
Other DBs
NCBI-GeneID: 100341540
NCBI-ProteinID: XP_008264339
Ensembl: ENSOCUG00000017800
LinkDB
Position
14:20668254..20745247
AA seq 868 aa
MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSXLRRAALGXPLDK
HEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEK
SCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALNREPTVDLS
PDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKE
VFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVSVKDF
SDKISRALTAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVP
VSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTK
STSVIEQGGIQTVDKLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTA
SNDLYKPLRAEGSNFRTVLDKAVQADGQVKERYQSHRDTIALLCKPEPELNAAIPSANPA
KTMQGSEVVNVLKSLLTNLDGVKKEREGLENDLKAVNFDMTSKFLTALAQDGVINEEALS
VTELDRVYGGLTSKVQESLKKQEELLRSIQVSHQEFSKMKQSNNEANLREEVLKNLAAAY
DNFVELVANLKEGTKFYNELTEILLRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAP
SIPTPAYQSSPAGGHAPAAPTPAPRTMPPTKPQPPARPPPPVLPANRTPSASAPAPVGTG
TPVPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQS
PGQAPFPGPQQPSYPFPQPPQQSYYPQQ
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggcgacgttcatctcggtgcagctgaagaagacgtcggaggtggacctggccaagccg
ctggtgaagttcatccagcagacctacccgagcggcggggaggagcaggcccagtactgc
cgcgcggccgaggagctcagcngcctgcgccgcgccgcgctcggcncgccgctggacaag
cacgagggcgcgctcgaaacgctgctgagatattatgatcagatttgttccattgaaccc
aaattcccattttctgaaaatcagatctgcttgacattcacctggaaggatgcttttgat
aaaggttcactttttggaggctctgtaaaattagctcttgcaagcttaggatatgaaaag
agctgtgtgttgttcaattgtgcagccttagctagccagattgcagcagaacagaacctg
gataacgatgaaggattgaaaatcgctgctaagcattaccagtttgctagtggtgccttt
ttacacattaaggagactgtgttatctgccttaaaccgagagcctactgtggacctatct
ccagatactgtcgggaccctcagtcttattatgctggcacaggctcaagaagtatttttt
ttaaaagctacaagagataaaatgaaggatgccatcatagctaagctggctaatcaggct
gcagattattttggcgatgccttcaaacagtgccagtacaaagacactctccccaaggag
gtgttccctgtcttggctgcaaagcactgtatcatgcaggccaatgctgaataccaccag
tctatcctggcaaaacagcagaagaaatttggagaagaaatagcaaggttacagcatgca
gcggaattgattaagacagtggcatctcgctatgatgaatacgtcagtgtaaaggatttt
tctgacaaaatcagccgtgcccttactgcagcaaagaaggataatgacttcatttatcat
gatcgagttccagaccttaaagatctagatcccattggcaaagccacacttgtgaaatct
acccctgtcaatgtacctatcagccagaaatttactgatctgtttgagaagatggttccc
gtgtcagttcaacagtctctggctgcctacaaccagaggaaagctgatttggttaacaga
tcaatcgctcaaatgagagaagccacgactttggcaaatggggtattagcttcacttaat
cttccagcagcaattgaagatgtatctggagatacagtacctcagtctatattgactaag
tccacatctgtgattgaacagggaggcatccagactgttgataagttgatcaaagaacta
cctgaactactacaaagaaatagagaaatcctagatgagtcattaagactactggatgaa
gaagaagcaacagacaatgacttaagagcaaaattcaaggaacgctggcaaaggacagca
tccaatgacctctataagcctttgagagcagagggaagcaacttcagaacagttttagat
aaagctgtgcaagctgatggacaagtgaaagaacgttatcagtctcatcgtgacaccatt
gcgcttctgtgtaagccggagcccgagctgaatgctgccatcccttctgctaacccagca
aagaccatgcagggcagcgaggttgttaatgtcttaaaatccttattgacaaatctcgat
ggcgtaaagaaggagagagaaggccttgagaatgacctgaaagccgtgaattttgacatg
acaagcaagtttttaacagctctggctcaagatggtgtgataaacgaagaagctctttct
gttactgaactggatcgagtctatggaggtcttacgtctaaagtgcaggagtcgctgaag
aagcaggaggagcttcttagaagtattcaggtctcacaccaggaattttcaaaaatgaaa
cagtctaacaatgaagctaacctaagagaagaagttttgaagaatttggctgctgcttat
gacaactttgttgaactcgtagctaatttgaaggagggcaccaagttttacaatgagctg
acggaaattctgctcaggttccagaacaaatgcagtgatatagtgtttgcacggaagaca
gaaagagatgaactcttaaaggacttgcagcagagcattgcccgagaacctagtgctcct
tcaatccctacgcctgcctatcagtcctctccagcagggggacacgcgccagctgctccg
accccagccccgaggaccatgccgcctacaaagccccagccccctgcccggcctccacct
cctgtgcttccagcaaatagaactccttctgcctctgctccggctcctgtgggaactgga
accccagtacctgctccatctcaaacccctggctcggcccctcctccacaggcccagggc
ccaccataccccacctatccaggataccctgggtattgccaaatgcccatgcccatgggc
tataatccttacgcgtacggccagtataacatgccctaccctccagtgtaccaccagagc
ccgggacaggctccgttcccaggaccccagcagccttcctaccccttccctcagccccca
cagcagtcctactatccacagcagtaa

DBGET integrated database retrieval system