KEGG   Oryctolagus cuniculus (rabbit): 100341680
Entry
100341680         CDS       T03373                                 
Symbol
GDF11
Name
(RefSeq) growth differentiation factor 11
  KO
K22679  growth differentiation factor 11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341680 (GDF11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100341680 (GDF11)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100341680 (GDF11)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 100341680
NCBI-ProteinID: XP_002711212
Ensembl: ENSOCUG00000024871
LinkDB
Position
4:39326638..39337993
AA seq 402 aa
MTSEKHAGYASVCGKGSRRETAAASAVPTLATAAAAGSGGERSSRPAPSVAPEPDGCPVC
VWRQHSRELRLESIKSQILSKLRLKEAPNISREVVKQLLPKAPPLQQILDLHDFQGDALQ
PEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMFTKVLKAQLWVYLR
PVPRPATVYLQILRLKPLTGEGTAGVGGGGRRHIRIRSLKIELHSRSGHWQSIDFKQVLH
SWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENTKRSRRNLGLDCD
EHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPR
GSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgacatcagaaaaacatgctggttatgccagcgtctgtgggaaaggctccaggcgggaa
actgctgcggcgtctgcggtgccgacgttggctacggcggctgcggccgggtccgggggt
gagcgctcgagccggccggccccgtccgtggcgccggagccggacggctgccccgtgtgc
gtgtggcggcagcacagccgcgagctgcgcctggagagcatcaagtcgcagatcctgagc
aagctgcggctcaaggaggcgcccaacatcagccgcgaggtggtgaagcagctgctgccc
aaggcgccgccgctgcagcagatcctggacctgcacgacttccagggcgacgcgctgcag
cccgaggacttcctggaggaggacgagtaccacgccaccactgagaccgtcattagcatg
gcccaggagaccgaccctgcggtgcagacagatggcagccctctctgctgccatttccac
ttcagccccaaggtgatgttcacaaaggtactgaaggcccagctgtgggtgtacctgcgg
ccagtgccccgcccagccacggtctacctacagatcttgcgactgaaacccctgactggg
gaagggaccgcaggggtagggggaggaggacgtcggcacatccgtatccgctcactcaag
attgagttgcactcgcgctccggccactggcagagcatcgacttcaagcaagtgctccac
agttggttccgccagccgcagagcaactggggcatcgagatcaacgcctttgatcccagt
ggcacagacctggctgtcacctccctggggccaggagctgaggggctgcaccctttcatg
gagcttcgagtcctagagaacacaaaacggtcccggcggaacctgggcctggactgtgat
gagcactccagtgagtcccgctgctgccgataccccctcacggtggactttgaggctttc
ggctgggactggatcatcgcacctaagcgctacaaggccaactactgctctggccagtgc
gagtacatgttcatgcaaaagtatccgcacacccatttggtgcaacaggccaacccaaga
ggctctgctgggccctgctgtacccccaccaagatgtccccaatcaacatgctctacttc
aatgacaagcagcagattatctacggcaagatccctggcatggtggtggatcgctgtggc
tgctcctaa

DBGET integrated database retrieval system