Oryctolagus cuniculus (rabbit): 100341695 Help Entry 100341695         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 14 isoform X1   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04015   Rap1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04114   Oocyte meiosis ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04370   VEGF signaling pathway ocu04380   Osteoclast differentiation ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04670   Leukocyte transendothelial migration ocu04714   Thermogenesis ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05014   Amyotrophic lateral sclerosis ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05205   Proteoglycans in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100341695    04015 Rap1 signaling pathway     100341695    04370 VEGF signaling pathway     100341695    04668 TNF signaling pathway     100341695    04068 FoxO signaling pathway     100341695    04071 Sphingolipid signaling pathway     100341695  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100341695   09143 Cell growth and death    04114 Oocyte meiosis     100341695    04218 Cellular senescence     100341695   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100341695  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100341695    04613 Neutrophil extracellular trap formation     100341695    04620 Toll-like receptor signaling pathway     100341695    04621 NOD-like receptor signaling pathway     100341695    04622 RIG-I-like receptor signaling pathway     100341695    04625 C-type lectin receptor signaling pathway     100341695    04660 T cell receptor signaling pathway     100341695    04658 Th1 and Th2 cell differentiation     100341695    04659 Th17 cell differentiation     100341695    04657 IL-17 signaling pathway     100341695    04664 Fc epsilon RI signaling pathway     100341695    04670 Leukocyte transendothelial migration     100341695   09152 Endocrine system    04912 GnRH signaling pathway     100341695    04914 Progesterone-mediated oocyte maturation     100341695    04917 Prolactin signaling pathway     100341695    04926 Relaxin signaling pathway     100341695    04935 Growth hormone synthesis, secretion and action     100341695   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100341695   09156 Nervous system    04728 Dopaminergic synapse     100341695    04723 Retrograde endocannabinoid signaling     100341695    04722 Neurotrophin signaling pathway     100341695   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100341695   09158 Development and regeneration    04380 Osteoclast differentiation     100341695   09159 Environmental adaptation    04714 Thermogenesis     100341695  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100341695    05208 Chemical carcinogenesis - reactive oxygen species     100341695    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100341695   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100341695    05161 Hepatitis B     100341695    05171 Coronavirus disease - COVID-19     100341695    05163 Human cytomegalovirus infection     100341695    05167 Kaposi sarcoma-associated herpesvirus infection     100341695    05169 Epstein-Barr virus infection     100341695   09171 Infectious disease: bacterial    05132 Salmonella infection     100341695    05135 Yersinia infection     100341695    05133 Pertussis     100341695    05152 Tuberculosis     100341695   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100341695    05140 Leishmaniasis     100341695    05142 Chagas disease     100341695   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100341695    05020 Prion disease     100341695    05022 Pathways of neurodegeneration - multiple diseases     100341695   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100341695    05418 Fluid shear stress and atherosclerosis     100341695    05415 Diabetic cardiomyopathy     100341695   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100341695    04932 Non-alcoholic fatty liver disease     100341695    04933 AGE-RAGE signaling pathway in diabetic complications     100341695   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100341695  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100341695 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100341695 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100341695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8 Motif Other DBs NCBI-GeneID:  100341695 NCBI-ProteinID:  XP_002714691 Ensembl:  ENSOCUG00000014799 UniProt:  A0A5F9DKW1 LinkDB All DBs Position 12:complement(129647341..129750008) Genome browser AA seq 360 aa AA seqDB search MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA QALAHDYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atgtctcaggagaggcccacgttctatcggcaggagctgaacaagacaatctgggaggtg cccgagcgttaccagaatctgtccccggtgggctctggcgcctatggctccgtgtgtgct gcttttgacacaaaaactgggttgcgcgttgctgtgaagaagctgtccaggccttttcag tccatcattcatgccaaaaggacctacagggagctgcggctactcaaacatatgaaacat gaaaatgtgattggtctattggacgtctttacacctgcaaggtctctggaggagttcaat gacgtgtatctggtgacgcatctcatgggggcagatctgaacaacattgtgaaatgccaa aagcttacagatgaccacgttcagttccttatctaccaaatcctccgaggcctaaagtat atacattcagcggacataattcacagggacctaaagcctagtaacctagctgtgaacgaa gactgtgagctgaagatcctggattttgggttggcgcgacacactgatgatgaaatgacg ggctacgtggccaccaggtggtatcgggctcctgagatcatgctgaactggatgcattac aaccagacagttgatatttggtcggtcggatgcataatggcggagctgttgactggaaga acactgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaaccccttg gccgttgacctgctggagaagatgcttgttttggactcagataagagaatcacagcagcc caagccctcgcgcacgactactttgcccagtaccacgatccggacgacgagccggtggcc gacccttacgatcagtcttttgaaagcagggacctgctcatagacgagtggaaaagcctg acctatgatgaagtcatcagcttcgtgccgccacccctcgaccaagaagagatggagtcc tga

Oryctolagus cuniculus (rabbit): 100344161 Help Entry 100344161         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 13   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04015   Rap1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04114   Oocyte meiosis ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04370   VEGF signaling pathway ocu04380   Osteoclast differentiation ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04670   Leukocyte transendothelial migration ocu04714   Thermogenesis ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05014   Amyotrophic lateral sclerosis ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05205   Proteoglycans in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100344161    04015 Rap1 signaling pathway     100344161    04370 VEGF signaling pathway     100344161    04668 TNF signaling pathway     100344161    04068 FoxO signaling pathway     100344161    04071 Sphingolipid signaling pathway     100344161  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100344161   09143 Cell growth and death    04114 Oocyte meiosis     100344161    04218 Cellular senescence     100344161   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100344161  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100344161    04613 Neutrophil extracellular trap formation     100344161    04620 Toll-like receptor signaling pathway     100344161    04621 NOD-like receptor signaling pathway     100344161    04622 RIG-I-like receptor signaling pathway     100344161    04625 C-type lectin receptor signaling pathway     100344161    04660 T cell receptor signaling pathway     100344161    04658 Th1 and Th2 cell differentiation     100344161    04659 Th17 cell differentiation     100344161    04657 IL-17 signaling pathway     100344161    04664 Fc epsilon RI signaling pathway     100344161    04670 Leukocyte transendothelial migration     100344161   09152 Endocrine system    04912 GnRH signaling pathway     100344161    04914 Progesterone-mediated oocyte maturation     100344161    04917 Prolactin signaling pathway     100344161    04926 Relaxin signaling pathway     100344161    04935 Growth hormone synthesis, secretion and action     100344161   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100344161   09156 Nervous system    04728 Dopaminergic synapse     100344161    04723 Retrograde endocannabinoid signaling     100344161    04722 Neurotrophin signaling pathway     100344161   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100344161   09158 Development and regeneration    04380 Osteoclast differentiation     100344161   09159 Environmental adaptation    04714 Thermogenesis     100344161  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100344161    05208 Chemical carcinogenesis - reactive oxygen species     100344161    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100344161   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100344161    05161 Hepatitis B     100344161    05171 Coronavirus disease - COVID-19     100344161    05163 Human cytomegalovirus infection     100344161    05167 Kaposi sarcoma-associated herpesvirus infection     100344161    05169 Epstein-Barr virus infection     100344161   09171 Infectious disease: bacterial    05132 Salmonella infection     100344161    05135 Yersinia infection     100344161    05133 Pertussis     100344161    05152 Tuberculosis     100344161   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100344161    05140 Leishmaniasis     100344161    05142 Chagas disease     100344161   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100344161    05020 Prion disease     100344161    05022 Pathways of neurodegeneration - multiple diseases     100344161   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100344161    05418 Fluid shear stress and atherosclerosis     100344161    05415 Diabetic cardiomyopathy     100344161   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100344161    04932 Non-alcoholic fatty liver disease     100344161    04933 AGE-RAGE signaling pathway in diabetic complications     100344161   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100344161  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100344161 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100344161 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100344161 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH Kinase-like Kdo Motif Other DBs NCBI-GeneID:  100344161 NCBI-ProteinID:  XP_002714701 Ensembl:  ENSOCUG00000014799 LinkDB All DBs Position 12:complement(129618187..129626105) Genome browser AA seq 366 aa AA seqDB search MSLTRRRGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF QSEIFARRAYRELLLLKHMQHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGM EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG VPGAEFVQKLKDKAAKTYIQSLPQMPKKDFTQLFPRASPQAVDLLEKMLELDVDKRLTAS QALAHPFFEPFRDPEEETEAQQPFDDALEHEKLTVDEWKQHIYKEIMGFSPVTRKDSRRR SGMKLQ NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt atgagcctcacccggagaaggggcttctacaagcaggacgtcaacaagaccgcctgggag ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctacggcgccgtgtgc tccgccatcgacaagcggtctggggagaaggtggccatcaagaagcttagccggcccttc cagtcggagatcttcgccaggcgggcctaccgcgagctgctgctgctcaaacacatgcag catgagaacgtcattgggctcctggatgtctttaccccagcctcctccctgcgcagcttc catgacttctacctggtgatgcccttcatgcagacggatctacagaagatcatgggcatg gagttcagtgaggacaagatccagtacctggtttaccagatgcttaaaggtcttaagtac atccactctgctggggtggtccacagggacctgaagccaggaaacctggccgtcaacgag gactgtgaactgaagatcctggattttgggctggcgcggcacgcggacgccgagatgacg ggctacgtggtgacgcgctggtaccgagcacccgaggtcatcctcagctggatgcactac aaccagaccgtggacatctggtcggtgggctgcatcatggcggagatgctgaccgggaag acgctgttcaagggcaaggactacctagaccagctgacccagatcctgaaagtgaccgga gtgcccggggccgagtttgtgcagaagctgaaggacaaagcagccaaaacctacatccag tccctgccccagatgcccaagaaggacttcactcagctcttcccacgggccagcccccag gccgtagacctgctggagaagatgctggaactggacgtggacaagcgcctgacggcctcg caggccctcgcccaccccttctttgaacccttccgggaccccgaggaagagacggaggcc cagcagccgttcgatgacgccttggaacacgagaagctcacagtggatgaatggaagcag cacatctacaaggagattatgggcttcagccccgtgacgcggaaggactcacggcgccgg agtggcatgaagctgcagtga

Oryctolagus cuniculus (rabbit): 100347345 Help Entry 100347345         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 1   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01522   Endocrine resistance ocu01524   Platinum drug resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04066   HIF-1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04114   Oocyte meiosis ocu04140   Autophagy - animal ocu04148   Efferocytosis ocu04150   mTOR signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04270   Vascular smooth muscle contraction ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04370   VEGF signaling pathway ocu04371   Apelin signaling pathway ocu04380   Osteoclast differentiation ocu04510   Focal adhesion ocu04520   Adherens junction ocu04540   Gap junction ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04666   Fc gamma R-mediated phagocytosis ocu04668   TNF signaling pathway ocu04713   Circadian entrainment ocu04720   Long-term potentiation ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04724   Glutamatergic synapse ocu04725   Cholinergic synapse ocu04726   Serotonergic synapse ocu04730   Long-term depression ocu04810   Regulation of actin cytoskeleton ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04915   Estrogen signaling pathway ocu04916   Melanogenesis ocu04917   Prolactin signaling pathway ocu04919   Thyroid hormone signaling pathway ocu04921   Oxytocin signaling pathway ocu04926   Relaxin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04929   GnRH secretion ocu04930   Type II diabetes mellitus ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04934   Cushing syndrome ocu04935   Growth hormone synthesis, secretion and action ocu04960   Aldosterone-regulated sodium reabsorption ocu05010   Alzheimer disease ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05034   Alcoholism ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05213   Endometrial cancer ocu05214   Glioma ocu05215   Prostate cancer ocu05216   Thyroid cancer ocu05218   Melanoma ocu05219   Bladder cancer ocu05220   Chronic myeloid leukemia ocu05221   Acute myeloid leukemia ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05230   Central carbon metabolism in cancer ocu05231   Choline metabolism in cancer ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100347345    04012 ErbB signaling pathway     100347345    04014 Ras signaling pathway     100347345    04015 Rap1 signaling pathway     100347345    04350 TGF-beta signaling pathway     100347345    04370 VEGF signaling pathway     100347345    04371 Apelin signaling pathway     100347345    04668 TNF signaling pathway     100347345    04066 HIF-1 signaling pathway     100347345    04068 FoxO signaling pathway     100347345    04072 Phospholipase D signaling pathway     100347345    04071 Sphingolipid signaling pathway     100347345    04024 cAMP signaling pathway     100347345    04022 cGMP-PKG signaling pathway     100347345    04151 PI3K-Akt signaling pathway     100347345    04150 mTOR signaling pathway     100347345  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100347345    04148 Efferocytosis     100347345   09143 Cell growth and death    04114 Oocyte meiosis     100347345    04210 Apoptosis     100347345    04218 Cellular senescence     100347345   09144 Cellular community - eukaryotes    04510 Focal adhesion     100347345    04520 Adherens junction     100347345    04540 Gap junction     100347345    04550 Signaling pathways regulating pluripotency of stem cells     100347345   09142 Cell motility    04810 Regulation of actin cytoskeleton     100347345  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100347345    04613 Neutrophil extracellular trap formation     100347345    04620 Toll-like receptor signaling pathway     100347345    04621 NOD-like receptor signaling pathway     100347345    04625 C-type lectin receptor signaling pathway     100347345    04650 Natural killer cell mediated cytotoxicity     100347345    04660 T cell receptor signaling pathway     100347345    04658 Th1 and Th2 cell differentiation     100347345    04659 Th17 cell differentiation     100347345    04657 IL-17 signaling pathway     100347345    04662 B cell receptor signaling pathway     100347345    04664 Fc epsilon RI signaling pathway     100347345    04666 Fc gamma R-mediated phagocytosis     100347345    04062 Chemokine signaling pathway     100347345   09152 Endocrine system    04910 Insulin signaling pathway     100347345    04929 GnRH secretion     100347345    04912 GnRH signaling pathway     100347345    04915 Estrogen signaling pathway     100347345    04914 Progesterone-mediated oocyte maturation     100347345    04917 Prolactin signaling pathway     100347345    04921 Oxytocin signaling pathway     100347345    04926 Relaxin signaling pathway     100347345    04935 Growth hormone synthesis, secretion and action     100347345    04919 Thyroid hormone signaling pathway     100347345    04928 Parathyroid hormone synthesis, secretion and action     100347345    04916 Melanogenesis     100347345   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100347345    04270 Vascular smooth muscle contraction     100347345   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100347345   09156 Nervous system    04724 Glutamatergic synapse     100347345    04725 Cholinergic synapse     100347345    04726 Serotonergic synapse     100347345    04720 Long-term potentiation     100347345    04730 Long-term depression     100347345    04723 Retrograde endocannabinoid signaling     100347345    04722 Neurotrophin signaling pathway     100347345   09158 Development and regeneration    04360 Axon guidance     100347345    04380 Osteoclast differentiation     100347345   09159 Environmental adaptation    04713 Circadian entrainment     100347345  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100347345    05206 MicroRNAs in cancer     100347345    05205 Proteoglycans in cancer     100347345    05207 Chemical carcinogenesis - receptor activation     100347345    05208 Chemical carcinogenesis - reactive oxygen species     100347345    05203 Viral carcinogenesis     100347345    05230 Central carbon metabolism in cancer     100347345    05231 Choline metabolism in cancer     100347345    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100347345   09162 Cancer: specific types    05210 Colorectal cancer     100347345    05212 Pancreatic cancer     100347345    05225 Hepatocellular carcinoma     100347345    05226 Gastric cancer     100347345    05214 Glioma     100347345    05216 Thyroid cancer     100347345    05221 Acute myeloid leukemia     100347345    05220 Chronic myeloid leukemia     100347345    05218 Melanoma     100347345    05211 Renal cell carcinoma     100347345    05219 Bladder cancer     100347345    05215 Prostate cancer     100347345    05213 Endometrial cancer     100347345    05224 Breast cancer     100347345    05223 Non-small cell lung cancer     100347345   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100347345    05170 Human immunodeficiency virus 1 infection     100347345    05161 Hepatitis B     100347345    05160 Hepatitis C     100347345    05171 Coronavirus disease - COVID-19     100347345    05164 Influenza A     100347345    05163 Human cytomegalovirus infection     100347345    05167 Kaposi sarcoma-associated herpesvirus infection     100347345    05165 Human papillomavirus infection     100347345   09171 Infectious disease: bacterial    05132 Salmonella infection     100347345    05135 Yersinia infection     100347345    05133 Pertussis     100347345    05152 Tuberculosis     100347345   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100347345    05140 Leishmaniasis     100347345    05142 Chagas disease     100347345   09164 Neurodegenerative disease    05010 Alzheimer disease     100347345    05020 Prion disease     100347345    05022 Pathways of neurodegeneration - multiple diseases     100347345   09165 Substance dependence    05034 Alcoholism     100347345   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100347345   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100347345    04933 AGE-RAGE signaling pathway in diabetic complications     100347345    04934 Cushing syndrome     100347345   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100347345    01524 Platinum drug resistance     100347345    01522 Endocrine resistance     100347345  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100347345   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100347345   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100347345 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100347345 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100347345 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      100347345 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100347345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo Motif Other DBs NCBI-GeneID:  100347345 NCBI-ProteinID:  XP_051682699 LinkDB All DBs Position 21:complement(6079552..6183400) Genome browser AA seq 360 aa AA seqDB search MAAAAAAGTGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggcggcgggcacgggcccggagatggtccgcgggcaggtgttcgac gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc tctgcttatgataatgtcaacaaagttcgagtggctatcaagaaaatcagtccttttgag caccagacctactgccagcgaaccctgagggagataaaaatcttactgcgcttcagacat gagaacatcattggaatcaatgacattattcgagccccaaccattgagcagatgaaagat gtatacatagtccaggacctcatggaaacagatctttacaagctcttgaagacacagcac ctcagcaacgaccatatctgctattttctctaccagatcctcagagggttaaaatacatc cattcagccaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc tgtgatctcaagatctgtgacttcggcctggcccgcgttgcggatccggaccatgatcac acagggttcctgacagagtatgtagccacgcgttggtacagggctccagaaattatgctg aattccaagggctacaccaagtccatcgacatctggtctgtaggctgcatcctggcggag atgctctccaacagacccatcttcccggggaagcactacctggaccagctgaaccacatt ctgggtattcttggatccccttcacaagaagacctgaattgtataataaacttaaaagcc agaaactatttgctttctcttccacacaaaaacaaggtgccatggaacaggctgtttcca aatgctgactccaaagctctggacttgctggacaagatgttgactttcaaccctcacaag aggatcgaagtagagcaggccctggcccacccctacctggagcagtattacgacccgagt gacgagcccatcgccgaagctccattcaagttcgacatggaattggatgacttgcctaag gaaaagctcaaagaactcatttttgaagagactgcgagattccagccaggatacagatct taa

Oryctolagus cuniculus (rabbit): 100348561 Help Entry 100348561         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 3   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01522   Endocrine resistance ocu01524   Platinum drug resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04066   HIF-1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04114   Oocyte meiosis ocu04140   Autophagy - animal ocu04148   Efferocytosis ocu04150   mTOR signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04270   Vascular smooth muscle contraction ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04370   VEGF signaling pathway ocu04371   Apelin signaling pathway ocu04380   Osteoclast differentiation ocu04510   Focal adhesion ocu04520   Adherens junction ocu04540   Gap junction ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04666   Fc gamma R-mediated phagocytosis ocu04668   TNF signaling pathway ocu04713   Circadian entrainment ocu04720   Long-term potentiation ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04724   Glutamatergic synapse ocu04725   Cholinergic synapse ocu04726   Serotonergic synapse ocu04730   Long-term depression ocu04810   Regulation of actin cytoskeleton ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04915   Estrogen signaling pathway ocu04916   Melanogenesis ocu04917   Prolactin signaling pathway ocu04919   Thyroid hormone signaling pathway ocu04921   Oxytocin signaling pathway ocu04926   Relaxin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04929   GnRH secretion ocu04930   Type II diabetes mellitus ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04934   Cushing syndrome ocu04935   Growth hormone synthesis, secretion and action ocu04960   Aldosterone-regulated sodium reabsorption ocu05010   Alzheimer disease ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05034   Alcoholism ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05213   Endometrial cancer ocu05214   Glioma ocu05215   Prostate cancer ocu05216   Thyroid cancer ocu05218   Melanoma ocu05219   Bladder cancer ocu05220   Chronic myeloid leukemia ocu05221   Acute myeloid leukemia ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05230   Central carbon metabolism in cancer ocu05231   Choline metabolism in cancer ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100348561    04012 ErbB signaling pathway     100348561    04014 Ras signaling pathway     100348561    04015 Rap1 signaling pathway     100348561    04350 TGF-beta signaling pathway     100348561    04370 VEGF signaling pathway     100348561    04371 Apelin signaling pathway     100348561    04668 TNF signaling pathway     100348561    04066 HIF-1 signaling pathway     100348561    04068 FoxO signaling pathway     100348561    04072 Phospholipase D signaling pathway     100348561    04071 Sphingolipid signaling pathway     100348561    04024 cAMP signaling pathway     100348561    04022 cGMP-PKG signaling pathway     100348561    04151 PI3K-Akt signaling pathway     100348561    04150 mTOR signaling pathway     100348561  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100348561    04148 Efferocytosis     100348561   09143 Cell growth and death    04114 Oocyte meiosis     100348561    04210 Apoptosis     100348561    04218 Cellular senescence     100348561   09144 Cellular community - eukaryotes    04510 Focal adhesion     100348561    04520 Adherens junction     100348561    04540 Gap junction     100348561    04550 Signaling pathways regulating pluripotency of stem cells     100348561   09142 Cell motility    04810 Regulation of actin cytoskeleton     100348561  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100348561    04613 Neutrophil extracellular trap formation     100348561    04620 Toll-like receptor signaling pathway     100348561    04621 NOD-like receptor signaling pathway     100348561    04625 C-type lectin receptor signaling pathway     100348561    04650 Natural killer cell mediated cytotoxicity     100348561    04660 T cell receptor signaling pathway     100348561    04658 Th1 and Th2 cell differentiation     100348561    04659 Th17 cell differentiation     100348561    04657 IL-17 signaling pathway     100348561    04662 B cell receptor signaling pathway     100348561    04664 Fc epsilon RI signaling pathway     100348561    04666 Fc gamma R-mediated phagocytosis     100348561    04062 Chemokine signaling pathway     100348561   09152 Endocrine system    04910 Insulin signaling pathway     100348561    04929 GnRH secretion     100348561    04912 GnRH signaling pathway     100348561    04915 Estrogen signaling pathway     100348561    04914 Progesterone-mediated oocyte maturation     100348561    04917 Prolactin signaling pathway     100348561    04921 Oxytocin signaling pathway     100348561    04926 Relaxin signaling pathway     100348561    04935 Growth hormone synthesis, secretion and action     100348561    04919 Thyroid hormone signaling pathway     100348561    04928 Parathyroid hormone synthesis, secretion and action     100348561    04916 Melanogenesis     100348561   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100348561    04270 Vascular smooth muscle contraction     100348561   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100348561   09156 Nervous system    04724 Glutamatergic synapse     100348561    04725 Cholinergic synapse     100348561    04726 Serotonergic synapse     100348561    04720 Long-term potentiation     100348561    04730 Long-term depression     100348561    04723 Retrograde endocannabinoid signaling     100348561    04722 Neurotrophin signaling pathway     100348561   09158 Development and regeneration    04360 Axon guidance     100348561    04380 Osteoclast differentiation     100348561   09159 Environmental adaptation    04713 Circadian entrainment     100348561  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100348561    05206 MicroRNAs in cancer     100348561    05205 Proteoglycans in cancer     100348561    05207 Chemical carcinogenesis - receptor activation     100348561    05208 Chemical carcinogenesis - reactive oxygen species     100348561    05203 Viral carcinogenesis     100348561    05230 Central carbon metabolism in cancer     100348561    05231 Choline metabolism in cancer     100348561    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100348561   09162 Cancer: specific types    05210 Colorectal cancer     100348561    05212 Pancreatic cancer     100348561    05225 Hepatocellular carcinoma     100348561    05226 Gastric cancer     100348561    05214 Glioma     100348561    05216 Thyroid cancer     100348561    05221 Acute myeloid leukemia     100348561    05220 Chronic myeloid leukemia     100348561    05218 Melanoma     100348561    05211 Renal cell carcinoma     100348561    05219 Bladder cancer     100348561    05215 Prostate cancer     100348561    05213 Endometrial cancer     100348561    05224 Breast cancer     100348561    05223 Non-small cell lung cancer     100348561   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100348561    05170 Human immunodeficiency virus 1 infection     100348561    05161 Hepatitis B     100348561    05160 Hepatitis C     100348561    05171 Coronavirus disease - COVID-19     100348561    05164 Influenza A     100348561    05163 Human cytomegalovirus infection     100348561    05167 Kaposi sarcoma-associated herpesvirus infection     100348561    05165 Human papillomavirus infection     100348561   09171 Infectious disease: bacterial    05132 Salmonella infection     100348561    05135 Yersinia infection     100348561    05133 Pertussis     100348561    05152 Tuberculosis     100348561   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100348561    05140 Leishmaniasis     100348561    05142 Chagas disease     100348561   09164 Neurodegenerative disease    05010 Alzheimer disease     100348561    05020 Prion disease     100348561    05022 Pathways of neurodegeneration - multiple diseases     100348561   09165 Substance dependence    05034 Alcoholism     100348561   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100348561   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100348561    04933 AGE-RAGE signaling pathway in diabetic complications     100348561    04934 Cushing syndrome     100348561   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100348561    01524 Platinum drug resistance     100348561    01522 Endocrine resistance     100348561  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100348561   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100348561   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100348561 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100348561 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100348561 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      100348561 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100348561 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo Motif Other DBs NCBI-GeneID:  100348561 NCBI-ProteinID:  XP_051703542 Ensembl:  ENSOCUG00000013716 LinkDB All DBs Position 6:complement(18466143..18472024) Genome browser AA seq 380 aa AA seqDB search MAAAAAAQGGGGGEPRGADGVGPGVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSA YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFSHENVIGIRDILRAPTLEAMRDVY IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPAKTKVAWAKLFPKS DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER LKELIFQETARFQPGAPEGP NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggagccgatggg gtcggcccgggggtccccggggaagtggaggtcgtgaaggggcagccgttcgacgtgggc ccacgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagcc tatgaccacgtgcgcaagacccgcgtggccatcaagaagatcagtcccttcgaacaccag acctactgccagcgcacgctgagggagatccagatcctgctacgcttctcccatgagaac gtcatcggcatccgggacattcttcgggctcccaccctggaagccatgagggatgtctac atcgtgcaggacctcatggagacagacctgtacaagttgctcaaaagccagcaactaagc aacgaccacatctgctacttcctctaccagatcctgcggggtctcaagtacatccactcg gccaacgtgctccaccgggacctgaagccctccaacctgctcatcaacaccacctgcgac cttaagatctgtgatttcggcctggcccgcattgcagaccctgaacatgaccacaccggc ttcctgacggagtacgtggccacgcgctggtaccgggccccagagatcatgctcaactcc aagggctatactaagtccatcgacatctggtctgtgggctgcatcctggccgagatgctc tccaaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctaggc atcctgggctcgccgtcccaggaggacctgaactgcatcatcaacatgaaggcccggaac tacctgcagtccctgcctgccaagaccaaggtggcctgggccaagctgtttcccaagtca gactccaaagccctggacctgctggatcggatgttgaccttcaaccccaacaagcgcatc actgtggaggaggccctggctcacccctacctggaacagtactatgacccgacggacgag ccggtggccgaggagcccttcaccttcgacatggagttggatgatctacccaaggagcgg ctgaaggagctcatcttccaggagacggcccgcttccagccgggggctccggaggggccc tag

Oryctolagus cuniculus (rabbit): 100350614 Help Entry 100350614         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 12 isoform X2   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04015   Rap1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04114   Oocyte meiosis ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04370   VEGF signaling pathway ocu04380   Osteoclast differentiation ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04670   Leukocyte transendothelial migration ocu04714   Thermogenesis ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05014   Amyotrophic lateral sclerosis ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05205   Proteoglycans in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100350614    04015 Rap1 signaling pathway     100350614    04370 VEGF signaling pathway     100350614    04668 TNF signaling pathway     100350614    04068 FoxO signaling pathway     100350614    04071 Sphingolipid signaling pathway     100350614  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100350614   09143 Cell growth and death    04114 Oocyte meiosis     100350614    04218 Cellular senescence     100350614   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100350614  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100350614    04613 Neutrophil extracellular trap formation     100350614    04620 Toll-like receptor signaling pathway     100350614    04621 NOD-like receptor signaling pathway     100350614    04622 RIG-I-like receptor signaling pathway     100350614    04625 C-type lectin receptor signaling pathway     100350614    04660 T cell receptor signaling pathway     100350614    04658 Th1 and Th2 cell differentiation     100350614    04659 Th17 cell differentiation     100350614    04657 IL-17 signaling pathway     100350614    04664 Fc epsilon RI signaling pathway     100350614    04670 Leukocyte transendothelial migration     100350614   09152 Endocrine system    04912 GnRH signaling pathway     100350614    04914 Progesterone-mediated oocyte maturation     100350614    04917 Prolactin signaling pathway     100350614    04926 Relaxin signaling pathway     100350614    04935 Growth hormone synthesis, secretion and action     100350614   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100350614   09156 Nervous system    04728 Dopaminergic synapse     100350614    04723 Retrograde endocannabinoid signaling     100350614    04722 Neurotrophin signaling pathway     100350614   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100350614   09158 Development and regeneration    04380 Osteoclast differentiation     100350614   09159 Environmental adaptation    04714 Thermogenesis     100350614  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100350614    05208 Chemical carcinogenesis - reactive oxygen species     100350614    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100350614   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100350614    05161 Hepatitis B     100350614    05171 Coronavirus disease - COVID-19     100350614    05163 Human cytomegalovirus infection     100350614    05167 Kaposi sarcoma-associated herpesvirus infection     100350614    05169 Epstein-Barr virus infection     100350614   09171 Infectious disease: bacterial    05132 Salmonella infection     100350614    05135 Yersinia infection     100350614    05133 Pertussis     100350614    05152 Tuberculosis     100350614   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100350614    05140 Leishmaniasis     100350614    05142 Chagas disease     100350614   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100350614    05020 Prion disease     100350614    05022 Pathways of neurodegeneration - multiple diseases     100350614   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100350614    05418 Fluid shear stress and atherosclerosis     100350614    05415 Diabetic cardiomyopathy     100350614   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100350614    04932 Non-alcoholic fatty liver disease     100350614    04933 AGE-RAGE signaling pathway in diabetic complications     100350614   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100350614  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100350614 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100350614 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100350614 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Haspin_kinase UvrD_C Kinase-like Motif Other DBs NCBI-GeneID:  100350614 NCBI-ProteinID:  XP_008249684 Ensembl:  ENSOCUG00000007543 LinkDB All DBs Position Unknown AA seq 367 aa AA seqDB search MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR PFQSELFAKRAYRELRLLQHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM KHEKLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK VTGTPPADFVQKLRSADAKQYMQGLPECERKDFASVVTNASPLAVNLLEKMLVLDGDQRV TAAEALAHPYFESLHDTEDEPTAQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR VSKETAL NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt atgagctcgccgccaccggcccgcaagggcttttaccgccaggaggtgaccaagaccgcc tgggaggtgcgcgctgtgtaccaggacctgcagcccgtgggctcgggcgcctacggcgcc gtgtgctcggcagtggacagccgcacgggcgccaaggtggccatcaagaagctgtaccgt cccttccagtcggagctgttcgccaagcgtgcctaccgcgagctgcgcctgctccagcac atgcgccacgagaacgtgatcggcctgctggacgtgttcaccccagacgagaccctggac gacttcacagacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg aagcacgagaagctgagtgaggaccgcatccagttcctggtgtaccagatgctgaagggg ctgaagtacatccacgctgctggcgtcatccacagggacctgaagcccggcaacctggca gtgaatgaggactgtgagctgaagatcctggactttggcctggccaggcaggctgacagt gagatgactggctatgtggtgacccggtggtaccgggcccccgaggtcatcctgaactgg atgcactacacacagacagtggacatctggtcggtgggctgcatcatggcggagatgatt acggggaagacgctgttcaagggcagtgaccacctggaccagctgaaggagatcatgaag gtgacagggacgcctccggccgacttcgtgcaaaagctgcggagcgctgatgccaagcag tacatgcagggcctccccgagtgtgagaggaaggactttgcctccgtggtgaccaacgca agccctctggccgtgaacctcctggagaagatgctggtgctggacggggaccagcgggtg acagcggccgaggcgctggcccacccctacttcgagtccctgcacgacacggaggacgag cccacagcccagaagtacgacgactcctttgatgacgtggaccgcaccctggacgagtgg aagcgtgtcacttacaaagaggtgctcagcttcaagcctcccaggcagctgggggccagg gtctccaaggagacggccctgtga

Oryctolagus cuniculus (rabbit): 103346035 Help Entry 103346035         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 11 isoform X1   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04015   Rap1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04114   Oocyte meiosis ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04370   VEGF signaling pathway ocu04380   Osteoclast differentiation ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04670   Leukocyte transendothelial migration ocu04714   Thermogenesis ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05014   Amyotrophic lateral sclerosis ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05205   Proteoglycans in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103346035    04015 Rap1 signaling pathway     103346035    04370 VEGF signaling pathway     103346035    04668 TNF signaling pathway     103346035    04068 FoxO signaling pathway     103346035    04071 Sphingolipid signaling pathway     103346035  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     103346035   09143 Cell growth and death    04114 Oocyte meiosis     103346035    04218 Cellular senescence     103346035   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     103346035  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103346035    04613 Neutrophil extracellular trap formation     103346035    04620 Toll-like receptor signaling pathway     103346035    04621 NOD-like receptor signaling pathway     103346035    04622 RIG-I-like receptor signaling pathway     103346035    04625 C-type lectin receptor signaling pathway     103346035    04660 T cell receptor signaling pathway     103346035    04658 Th1 and Th2 cell differentiation     103346035    04659 Th17 cell differentiation     103346035    04657 IL-17 signaling pathway     103346035    04664 Fc epsilon RI signaling pathway     103346035    04670 Leukocyte transendothelial migration     103346035   09152 Endocrine system    04912 GnRH signaling pathway     103346035    04914 Progesterone-mediated oocyte maturation     103346035    04917 Prolactin signaling pathway     103346035    04926 Relaxin signaling pathway     103346035    04935 Growth hormone synthesis, secretion and action     103346035   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103346035   09156 Nervous system    04728 Dopaminergic synapse     103346035    04723 Retrograde endocannabinoid signaling     103346035    04722 Neurotrophin signaling pathway     103346035   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103346035   09158 Development and regeneration    04380 Osteoclast differentiation     103346035   09159 Environmental adaptation    04714 Thermogenesis     103346035  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103346035    05208 Chemical carcinogenesis - reactive oxygen species     103346035    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103346035   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103346035    05161 Hepatitis B     103346035    05171 Coronavirus disease - COVID-19     103346035    05163 Human cytomegalovirus infection     103346035    05167 Kaposi sarcoma-associated herpesvirus infection     103346035    05169 Epstein-Barr virus infection     103346035   09171 Infectious disease: bacterial    05132 Salmonella infection     103346035    05135 Yersinia infection     103346035    05133 Pertussis     103346035    05152 Tuberculosis     103346035   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103346035    05140 Leishmaniasis     103346035    05142 Chagas disease     103346035   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103346035    05020 Prion disease     103346035    05022 Pathways of neurodegeneration - multiple diseases     103346035   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103346035    05418 Fluid shear stress and atherosclerosis     103346035    05415 Diabetic cardiomyopathy     103346035   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103346035    04932 Non-alcoholic fatty liver disease     103346035    04933 AGE-RAGE signaling pathway in diabetic complications     103346035   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103346035  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     103346035 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103346035 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103346035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH RIO1 Cas_CT1975 Motif Other DBs NCBI-GeneID:  103346035 NCBI-ProteinID:  XP_051695176 LinkDB All DBs Position Unknown AA seq 364 aa AA seqDB search MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA EALAHAYFSQYHDPDDEPVAEPYDESVEAKERTVEEWKELTYQEVLSFKPPESPQPSGSL DIEQ NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt atgtcggggccccgcgccggcttctaccggcaggagctgaacaagacggtgtgggaggtg ccgcagaggctgcaggggctgcgcccggtgggctccggcgcctacggctcggtctgctca gcctacgacgcccggctgcggcagaaggtggcggtgaagaagctctcgcggcccttccag tcgctgatccacgcccgcaggacgtaccgggagctgcggctgctcaagcacctcaagcat gagaacgtcatcgggcttctggacgtcttcacgccagccacgtccatcgaggacttcagt gaagtgtacttggtgaccaccctgatgggcgcagacctgaacaacatcgtcaagtgccag gcgctgagtgacgaacacgtccagttcctggtataccagctgctgcgtgggctgaagtac atccactctgcagggatcatccaccgggacctgaaacccagcaacgtggcggtgaatgaa gactgcgagctcaggatcctagacttcggactggcccgccaggctgacgaggagatgacc ggctacgtggccacacgctggtaccgagccccagagatcatgctgaactggatgcactac aaccagacagtggatatctggtccgtgggctgtatcatggccgagctgctgcaggggaag gctctcttcccgggaagtgactacatcgaccagctgaagcggatcatggaggtggtgggt acgcccagccctgaggttctggccaagatttcctcggagcacgcccggacctacatccag tctctgccccccatgcctcagaaggacctcagcagcatcttccgcggagccaaccccctg gctatagatctcctcgggaggatgctggtgctggacagcgaccagcgggtcagcgccgcg gaggccctggcccacgcctacttcagccagtaccacgaccccgacgatgagccggtggcc gagccctatgatgaaagcgttgaggccaaggagcgcacagtggaggagtggaaggagctc acctaccaggaggttctcagcttcaagcccccggagtcaccacagccatctggtagcctg gacattgagcagtga

DBGET integrated database retrieval system