KEGG   Oryctolagus cuniculus (rabbit): 100341760
Entry
100341760         CDS       T03373                                 
Symbol
IL1F10
Name
(RefSeq) interleukin 1 family member 10 (theta)
  KO
K05488  interleukin 1 family member 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341760 (IL1F10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100341760 (IL1F10)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100341760 (IL1F10)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 100341760
NCBI-ProteinID: XP_002709657
Ensembl: ENSOCUG00000005319
LinkDB
Position
2:97817834..97827159
AA seq 152 aa
MCSLPMARYYIIKDTDQKVLYIRDGQLLVGDPDVDKCSAEKICILPNRDLDRAKVPILLG
TQGGSRCLACVETEAGPSLQLEDVNIEDLYKGGEEATRFTFFQSSLGSAFRLEAAAWPGW
FVSGPAEPEQPVQLTKESEPTARTEFYFEQSR
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtgttccctgcctatggcgagatactacataatcaaagacacagaccagaaggttctg
tacataagagatggccagctgctggtgggagatcctgatgtagacaagtgcagtgcggag
aagatctgcatccttccaaacagagacctggaccgcgccaaggtccccatcctcctgggg
acccagggtgggagccgctgcctggcatgtgtggagacagaagctgggccttctctacaa
ctagaggatgtgaacatcgaggacctctacaaggggggtgaagaggccacacgcttcacc
ttcttccagagcagcctgggctctgccttcaggctggaggctgctgcctggcctggctgg
ttcgtcagtggcccggccgagcccgagcagccagtgcagctcaccaaggagagcgagccc
acggcccgcaccgagttctactttgagcagagtcggtag

DBGET integrated database retrieval system