KEGG   Oryctolagus cuniculus (rabbit): 100341861
Entry
100341861         CDS       T03373                                 
Symbol
CISH
Name
(RefSeq) cytokine inducible SH2 containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04630  JAK-STAT signaling pathway
ocu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100341861 (CISH)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100341861 (CISH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100341861 (CISH)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100341861 (CISH)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 100341861
NCBI-ProteinID: XP_002713265
Ensembl: ENSOCUG00000013904
UniProt: G1TQ50
LinkDB
Position
9:complement(18051132..18056845)
AA seq 257 aa
MVLCVEGPCPLLAVEQIGQRPLWARSLELPGPAMQPLPAVAFLEEVAEETPAQPESESKV
LDPEEDLMCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAP
GPALPVPKEDTPGDPALPAPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVTDVDCL
PLPQRMADYLRQYPFRL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggtcctctgcgttgagggaccttgtcctttgctggctgtggagcagatcgggcagcgg
cccctgtgggcccggtccctggagctgcccggaccagccatgcagcccttacctgctgtg
gccttcctggaggaggtggcagaggagaccccagcccagccagagagtgaatcaaaggtg
ctggaccctgaggaggatctgatgtgcatagccaagactttctcctaccttcgggaatct
ggctggtattggggttccattacggccagtgaggcccggcaacacctgcagaagatgcca
gagggcacgttcctagttcgagacagcacccaccccagttacctgttcacgctgtcagtc
aagaccacccgcggccccaccaacgtgcgcattgagtatgccgactccagcttccgcctg
gactcgaactgcttgtccaggccacgcatcctggccttcccagacgtggtcagccttgtg
cagcactacgtggcctcctgtgctgctgacactcgaagtgacagccctgatcctgctccc
ggcccagccctgcctgtccccaaggaagatacgcccggtgaccctgcgctgcctgccccc
gtggccactgccgtgcacctgaaactggtgcagccctttgtgcgcagaagcagcgcccgc
agcctgcagcacctctgccgccttgtcatcaaccgcctggtgaccgacgtggactgcctg
ccactgccccagcgcatggctgactacctccgacagtaccccttccggctctga

DBGET integrated database retrieval system