KEGG   Oryctolagus cuniculus (rabbit): 100341879
Entry
100341879         CDS       T03373                                 
Symbol
NTNG1
Name
(RefSeq) netrin G1
  KO
K07522  netrin-G1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100341879 (NTNG1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100341879 (NTNG1)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF EGF_2
Other DBs
NCBI-GeneID: 100341879
NCBI-ProteinID: XP_002715864
Ensembl: ENSOCUG00000023952
LinkDB
Position
13:complement(56635427..57034118)
AA seq 545 aa
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDVCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYSTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTC
HNNVRCLCPAAYTGILCEKLRCEEAGSCGPDSGQGPPAHSKPALPLLLLLLLLSALLGAA
NPLVF
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgtatttgtcaagattcctgtcgatccatgccctttgggtcaccgtgtcctcagtgatg
cagccctaccctttggtgtgggggcattacgacgtgtgtaagacgcagatttacacagaa
gaaggaaaagtttgggattacatggcctgtcagcctgaatccacggacatgacaaaatac
ctgaaagtgaagctggaccctccggatattacctgtggagatcctcctgagaccttctgt
gcaatgggtaacccttatatgtgcaataatgaatgtgatgctagcacccctgagctggca
cacccccctgagctgatgtttgattttgaaggaagacacccctccacattttggcagtct
gctacttggaaggagtatcccaagcctctgcaagtgaacatcactctgtcttggagcaaa
accattgagctcacagacaacatagtgatcacctttgaatcggggcggccagaccaaatg
atcctggagaaatcactggattatggacgaacatggcagccctatcagtattacgctaca
gactgcttagatgcgtttcacatggatcccaaatctgtgaaggatttgtcacagcacacg
gtcttagaaataatttgtacagaagagtactccacgggctattccacaaatagcaaaata
atccactttgaaatcaaagacaggttcgcgttttttgctggacctcggctacgcaatatg
gcttccctgtacggacagctggatacaaccaagaaactcagagatttcttcacagtcaca
gacctgaggataaggctgttgagaccagctgttggggaaatatttgtcgatgagctccac
ttggcacgctacttttatgcaatctcagacataaaggtgcgaggaaggtgcaagtgtaat
ctccatgccacagtgtgtgtgtatgacaacagcaaactgacatgtgaatgtgagcacaac
actacaggcccagactgtgggaaatgcaagaagaattatcagggccgaccttggagtcca
ggctcgtatctccccatccccaaaggcactgcaaatacctgtatccccagtatttccagt
atcggtaactgtgaatgcttcggccactccaatcgatgcagttatatcgatctgctaaat
acagtcatttgcgtgagctgtaaacacaacactagagggcagcactgtgagttatgcagg
ctgggctacttcagaaatgcttctgcacagctggacgatgagaatgtgtgcatagagtgt
tattgtaaccctttgggctcaatccatgatcgttgtaatggctcaggattttgtgagtgt
aagactggaacgacagggcctaagtgtgatgagtgtctgccgggaaattcctggcactac
ggctgtcaaccgaatgtctgcgacaacgagctcctgcactgtcagaacggagggacatgc
cacaacaatgtgcgctgcctgtgcccggccgcctacaccggcatcctgtgcgagaagctg
cggtgcgaggaggcgggcagctgcgggccggactccggccaggggccgcctgcgcacagc
aagcccgccctgccgctgctcctgctgctgctcctgctgagcgcgctgctgggggccgcc
aaccccctggtgttctag

DBGET integrated database retrieval system