KEGG   Oryctolagus cuniculus (rabbit): 100341910
Entry
100341910         CDS       T03373                                 
Symbol
IFNE
Name
(RefSeq) interferon epsilon
  KO
K05442  interferon epsilon
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04622  RIG-I-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100341910 (IFNE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341910 (IFNE)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100341910 (IFNE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100341910 (IFNE)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interferons
   100341910 (IFNE)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100341910
NCBI-ProteinID: XP_017204416
UniProt: A0A7R8GV23
LinkDB
Position
1:32281221..32281793
AA seq 190 aa
MTYKYFFEIVLVLLASSTIFSLKLKRVPFQQRRMNTRSLKPWNNLQKLRIQQCLPHRNDF
RLPLKSVNPHQYQKAQVLAVIHETLQQIFSLFRENISLGGGEKNDLEKFLIELHQELQYL
EGFMELEAKQESGALGSEILRLQIKTYFLRIRDYLEAQDYSICAWIIVQVEINRCLFFVF
RLTEMLNKKS
NT seq 573 nt   +upstreamnt  +downstreamnt
atgacttacaagtacttctttgaaattgtgttggtgctgctggcctcatctactatcttc
tccctaaaactgaaacgggttcccttccaacaaagaagaatgaacacaaggagtttaaaa
ccctggaataatttacaaaagttgagaatccagcaatgtctaccacacaggaatgatttc
cggcttcccctgaagtctgtgaatcctcatcagtaccaaaaggcacaagtactggctgta
atccatgagacacttcagcagatcttcagcctcttcagagaaaatatttccctgggtggt
ggggagaaaaatgacttggagaaattcctgattgaacttcatcaagagctgcagtaccta
gaaggattcatggaactggaagcgaagcaggaaagtggagccttgggtagtgagatcctt
aggttacagattaaaacatatttcctgaggatccgtgactacctggaagcccaggactac
agtatctgtgcctggatcattgtccaggtggaaatcaaccgatgtctcttctttgtgttc
agactcacagaaatgctgaacaaaaagagctag

DBGET integrated database retrieval system