KEGG   Oryctolagus cuniculus (rabbit): 100342035
Entry
100342035         CDS       T03373                                 
Symbol
LRRC4
Name
(RefSeq) leucine rich repeat containing 4
  KO
K16351  netrin-G2 ligand
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100342035 (LRRC4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100342035 (LRRC4)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Ig_3 I-set DAG1 LRRNT Insulin_TMD
Other DBs
NCBI-GeneID: 100342035
NCBI-ProteinID: XP_008256459
LinkDB
Position
7:16293354..16296223
AA seq 655 aa
MKLLWQVTLPPTWNASCFPVVFLTAQVWILLCSIAAAASAGPQNRPSVCSCSNQFSKVVC
TRRGLSEVPQGIPSNTRFLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNG
LASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNQPNPIESIPSCLSTECPSLMRLDLG
ELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFH
GLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFSPLRYLVELHLHH
NPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAP
RDLNISESRMAELKCRTPPMSSVKWLLPNGTVLSHASRPPSISFPYTIATLNFFPVLLSD
TEVYTCMLCNVAGNSNASLYLNVSAAELNTSXLQFLHTVTVETTEISPEDXTRKYKPVPT
TSLATSRAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTL
LAAAMLIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAAASAAATAAPASVSGEGAVVL
PTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgaagctcttgtggcaagtaactttgccccccacctggaatgcctcctgcttccccgtc
gttttcctcacggcacaagtgtggattctgttgtgcagcatcgctgctgccgcctcggcc
gggccccagaaccgcccctccgtctgctcgtgcagtaaccagttcagcaaggtggtgtgc
acccgccggggcctctccgaggttccacagggcattccctccaacacccggttcctcaac
ctcatggaaaacaatatccagatgatccaggccgacacctttcgacacctccaccacctg
gaggtcctgcagctgggcaggaactccatccggcagatcgaggtgggggccttcaacggc
ctggccagcctcaacaccctggagctgttcgacaactggctgactgtcatccccagcggg
gccttcgaatacctgtccaaactgcgggagctctggcttcgcaaccaacccaaccctata
gaaagcatcccctcctgcctttcaaccgagtgcccctccctcatgcgcctggacttgggg
gagctcaagaagctggagtatatctctgagggcgcctttgaggggctcttcaacctcaag
tacctgaacttgggtatgtgcaacattaaagatatgcccaacctcacccccctggtgggg
ctggaggagctggagatgtcagggaaccactttcctgagatcaggcctggatccttccat
ggcctgagctccctcaagaagctgtgggtcatgaactcgcaggtgagcctgattgagcgg
aatgctttcgacgggctggcctcgcttgtggaactcaacctggctcacaacaacctctcc
tctctgccccacgacctcttcagcccactgaggtacctggtggagttgcacttacaccac
aatccctggaactgtgactgcgacatcctgtggctggcctggtggcttcgggagtatata
cccaccaactccacgtgctgcggccgctgtcacgctcccatgcacatgcgaggccgctac
ctggtggaggtggaccaggcctccttccagtgctctgcccccttcatcatggacgcgcct
cgggacctcaacatctctgagagtcggatggcggaactcaagtgtcggactccccccatg
tcctcggtgaagtggctgctgcccaatgggacagtgctcagccacgcctcccgccccccc
agcatatcatttccttatacgatagcaaccttgaacttttttcccgtgctgctctcagac
acggaagtatacacatgcatgctgtgcaacgtggctggcaactccaacgcctcgctctac
ctcaacgtgagcgcggccgagctcaacacctcctaactacagtttcttcacacagtcaca
gtggagaccacggagatctcgcctgaggacnacacgaggaagtacaagcctgtgcccacc
acgtcactggctaccagccgggcatataccacctctaccacggtgctcattcagaccacc
cgtgtgcccaagcaggtggcggtacccgcgacagacaccactgacaagatgcagaccagc
ctggatgaagtcatgaagaccaccaagatcatcattggttgctttgtggcagtgactctg
ctggctgccgccatgttgattgtcttctacaagctccggaagcggcaccagcagcggagt
accgtcacggccgccaggacagttgagattatccaggtggacgaagacatcccggcggcg
gcttcggcggcggcaacagcggctccagccagtgtatcaggtgagggggcagtagtgctg
cccacaattcatgaccatattaactacaacacctacaaaccagcacatggggcccactgg
acagaaaacagcctggggaactctctgcaccccacagtcaccactatctctgaaccttat
ataattcagacccataccaaggacaaggtacaggaaactcaaatatga

DBGET integrated database retrieval system