KEGG   Oryctolagus cuniculus (rabbit): 100342081
Entry
100342081         CDS       T03373                                 
Symbol
TNFSF8
Name
(RefSeq) tumor necrosis factor superfamily member 8
  KO
K05471  tumor necrosis factor ligand superfamily member 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100342081 (TNFSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100342081 (TNFSF8)
   04090 CD molecules [BR:ocu04090]
    100342081 (TNFSF8)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100342081 (TNFSF8)
CD molecules [BR:ocu04090]
 Proteins
  100342081 (TNFSF8)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100342081
NCBI-ProteinID: XP_002720560
Ensembl: ENSOCUG00000009977
LinkDB
Position
Un
AA seq 232 aa
MEPGLQQALQRGPPSAEAAMHVPAGPAAGPWGPRSRSYFCFTTALLALCLVFTVATFMVL
VVRRADSIPNPPDNFPLKGGNCSEDLLCILKRAPFKKSWAYLQVSKHLNSTRLSWNKDGI
VHGVTYHDGKLVIQFPGWYFIICQLQFLVQCSNHSVDLKLELLVNKEVKREALVTVCESG
LPTREIYQNLSQFLLDYLQVNATISVMVDKFQYVDTNTFPLENVLSIFLYSS
NT seq 699 nt   +upstreamnt  +downstreamnt
atggagccagggctgcagcaggcactccagcgagggcccccttccgcagaggcggccatg
cacgtgcccgccggccctgcagccggcccctggggacccaggagccgcagctacttctgc
ttcaccacagccttgctggctctgtgccttgtcttcaccgtggcaaccttcatggtactg
gtcgttcgcagagcggactccattcccaacccacctgacaacttcccccttaaaggagga
aactgctccgaagacctcttatgtatccttaaaagggccccattcaagaagtcatgggcg
tacctccaagtgtccaagcatctcaacagcaccaggttgtcttggaacaaagatggcatt
gtccatggagtcacataccatgacgggaagctggtgatccagttcccaggttggtacttc
atcatttgccaactgcagtttcttgtgcaatgttcaaaccattcagtggacctgaagttg
gagcttctcgtcaacaaagaggtcaaaagagaagccctggtgacagtgtgtgaatctgga
ctgccaaccagagagatataccagaatctctctcaattcttgttggattacttgcaggtc
aatgccaccatatcagtgatggtagacaaattccagtatgtggataccaacacctttcct
cttgaaaatgtgctgtctatcttcttatatagcagttaa

DBGET integrated database retrieval system