KEGG   Oryctolagus cuniculus (rabbit): 100342147
Entry
100342147         CDS       T03373                                 
Symbol
ANAPC16
Name
(RefSeq) anaphase promoting complex subunit 16
  KO
K25229  anaphase-promoting complex subunit 16
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342147 (ANAPC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100342147 (ANAPC16)
   04114 Oocyte meiosis
    100342147 (ANAPC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100342147 (ANAPC16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100342147 (ANAPC16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342147 (ANAPC16)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100342147 (ANAPC16)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100342147 (ANAPC16)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100342147 (ANAPC16)
SSDB
Motif
Pfam: ANAPC16 DUF2110
Other DBs
NCBI-GeneID: 100342147
NCBI-ProteinID: XP_002718479
Ensembl: ENSOCUG00000016767
UniProt: G1TCB4
LinkDB
Position
18:complement(15179269..15190590)
AA seq 110 aa
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFS
YQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG
NT seq 333 nt   +upstreamnt  +downstreamnt
atggctgcctcgtcgtcgtcctcctcggctggtggggtcagtgggagttctgtcactgga
tctggtttcagtgtgtcagacctcgccccaccacggaaagcccttttcacctaccccaaa
ggagctggagagatgttagaagatggctctgagagatttctctgcgagtccgttttcagc
tatcaagtggcatccacacttaaacaggtgaaacatgatcagcaggttgctcggatggaa
aaactcgctggtttggtagaagagctggaggccgatgagtggcggttcaaacccatcgag
cagctgctggggttcacgccctcttcaggttaa

DBGET integrated database retrieval system